# Other Social Trends & Public Discussions — 2026-09-29 19:50 UTC

> **Category:** Other  
> **Status:** Trending Up  
> **Timestamp:** 2026-09-29 19:50 UTC (2026-09-29T19:50:00Z)  
> **Canonical URL:** https://cryptitalk.com/2026-09-29-19-50/non_crypto/other  
> **Overview Brief:** https://cryptitalk.com/2026-09-29-19-50/non_crypto.md  

---

## 10-Minute Category Volume & Sentiment
- **Total Posts:** 321
- **Total Impressions:** 2.27M
- **Bullish / Positive:** 47
- **Bearish / Negative:** 17
- **Neutral:** 257

---


## Engagement Analysis
Total Engagement - Comments: 2831, Retweets: 2337, Likes: 42296, Impressions: 2268575


---

## Cited Discussions & Public Evidence


### Discussion #1 by @reddit
> **Author:** [@reddit](https://x.com/reddit)  
> **Metrics:** 7.6K likes · 75 retweets · 204 comments · 759.7K views  

> **Posted:** 2026-09-29T19:08:43.960000+00:00  



> 
> "My cat's nose glitters in direct sunlight"


### Discussion #2 by @Acosta
> **Author:** [@Acosta](https://x.com/Acosta)  
> **Metrics:** 3.9K likes · 293 retweets · 47 comments · 259.9K views  

> **Posted:** 2026-09-29T16:13:50+00:00  


> **Source Link:** [https://x.com/Acosta/status/2104967901463625913](https://x.com/Acosta/status/2104967901463625913)  


> 
> "This is cool."


### Discussion #3 by @ZinhleM_3
> **Author:** [@ZinhleM_3](https://x.com/ZinhleM_3)  
> **Metrics:** 2.2K likes · 221 retweets · 66 comments · 242.7K views  

> **Posted:** 2026-09-29T15:20:39+00:00  


> **Source Link:** [https://x.com/ZinhleM_3/status/2104954517502427463](https://x.com/ZinhleM_3/status/2104954517502427463)  


> 
> "Fam! 

Apply for annual leave for the 23rd to 25th of March 2027!

You're welcome ."


### Discussion #4 by @Melinadenfina99
> **Author:** [@Melinadenfina99](https://x.com/Melinadenfina99)  
> **Metrics:** 1.7K likes · 74 retweets · 84 comments · 212.0K views  

> **Posted:** 2026-09-29T05:57:31+00:00  


> **Source Link:** [https://x.com/Melinadenfina99/status/2104812797721018747](https://x.com/Melinadenfina99/status/2104812797721018747)  


> 
> "Good morning There's no better way to start the day than like this"


### Discussion #5 by @556god
> **Author:** [@556god](https://x.com/556god)  
> **Metrics:** 5.9K likes · 403 retweets · 43 comments · 199.5K views  

> **Posted:** 2026-09-29T16:52:47+00:00  


> **Source Link:** [https://x.com/556god/status/2104977703715619326](https://x.com/556god/status/2104977703715619326)  


> 
> "Book tripped"


### Discussion #6 by @Nikit118
> **Author:** [@Nikit118](https://x.com/Nikit118)  
> **Metrics:** 4.4K likes · 104 retweets · 75 comments · 104.0K views  

> **Posted:** 2026-09-29T10:12:28+00:00  


> **Source Link:** [https://x.com/Nikit118/status/2104876958358110524](https://x.com/Nikit118/status/2104876958358110524)  


> 
> "HRNYY & W3T ASFFF…"


### Discussion #7 by @ShaneStoffer
> **Author:** [@ShaneStoffer](https://x.com/ShaneStoffer)  
> **Metrics:** 624 likes · 13 retweets · 105 comments · 70.1K views  

> **Posted:** 2026-09-29T04:00:04+00:00  


> **Source Link:** [https://x.com/ShaneStoffer/status/2104783243128279322](https://x.com/ShaneStoffer/status/2104783243128279322)  


> 
> "I’m only on this app cuz I make money to be here. U guys fr ruin my day every time open this app lmao. Especially crypto niggas."


### Discussion #8 by @FCBbasket
> **Author:** [@FCBbasket](https://x.com/FCBbasket)  
> **Metrics:** 274 likes · 66 retweets · 31 comments · 45.6K views  

> **Posted:** 2026-09-29T18:03:12+00:00  


> **Source Link:** [https://x.com/FCBbasket/status/2104995423937069326](https://x.com/FCBbasket/status/2104995423937069326)  


> **Visual Context:** The image shows a basketball player wearing a Barcelona jersey (#5) with the final score displayed as "94-87" between FC Barcelona and Bilbao Basket, alongside the text "FINAL." This visually reinforces the "Final." caption by confirming the game's outcome, with Barcelona's victory reflected in the higher score.  

> 
> "Final."


### Discussion #9 by @Nailocs
> **Author:** [@Nailocs](https://x.com/Nailocs)  
> **Metrics:** 4.0K likes · 111 retweets · 9 comments · 39.3K views  

> **Posted:** 2026-09-29T17:52:49+00:00  


> **Source Link:** [https://x.com/Nailocs/status/2104992811993235576](https://x.com/Nailocs/status/2104992811993235576)  


> 
> "I ran into a buddy chatting up a chick, and when he spotted me, I signaled him not to interrupt, but the dude left the girl hanging to come over and ask me what the hell I was trying to tell him."


### Discussion #10 by @odinerites
> **Author:** [@odinerites](https://x.com/odinerites)  
> **Metrics:** 2.1K likes · 47 retweets · 7 comments · 36.9K views  

> **Posted:** 2026-09-29T18:11:06+00:00  


> **Source Link:** [https://x.com/odinerites/status/2104997409994559685](https://x.com/odinerites/status/2104997409994559685)  


> **Visual Context:** Fenerbahçe basketball player #1 is shown yelling in celebration during a EuroLeague game against Bayern Munich. The scoreboard shows Fenerbahçe leading 14-7 with 5:19 remaining in the 1st quarter, featuring Etihad Airways and Abu Dhabi sponsorships, with Fenerbahçe fans visible in the crowd wearing yellow and blue. The image aligns with the post's motivational message by capturing an emotional, determined moment of a player channeling hunger and a potential turning point through his intense expression and rallying presence on the court.  

> 
> "Let us quench your long hunger, and we will be the turning point of your career..."


### Discussion #11 by @elendegenerates
> **Author:** [@elendegenerates](https://x.com/elendegenerates)  
> **Metrics:** 2.2K likes · 58 retweets · 1 comments · 36.9K views  

> **Posted:** 2026-09-29T14:06:37+00:00  


> **Source Link:** [https://x.com/elendegenerates/status/2104935885523615941](https://x.com/elendegenerates/status/2104935885523615941)  


> 
> "unannounced runnin but naked round the house"


### Discussion #12 by @BarronTrump_RVQ
> **Author:** [@BarronTrump_RVQ](https://x.com/BarronTrump_RVQ)  
> **Metrics:** 183 likes · 38 retweets · 1.4K comments · 33.1K views  

> **Posted:** 2026-09-29T17:09:51+00:00  


> **Source Link:** [https://x.com/BarronTrump_RVQ/status/2104981995365277926](https://x.com/BarronTrump_RVQ/status/2104981995365277926)  


> **Visual Context:** A man holds a cardboard sign displaying a purple circuit-patterned shirt with visible holes, accompanied by the text "99% fail — How many holes are in the shirt?" This image serves as the visual challenge for the contest referenced in the post, where participants must correctly count the shirt's holes to win $5,000.  

> 
> "How many holes are in shirt? 

No one has been able to get correctly 

Winner gets 
$5000

Ends in 24 hours"


### Discussion #13 by @miki_p1
> **Author:** [@miki_p1](https://x.com/miki_p1)  
> **Metrics:** 416 likes · 8 retweets · 60 comments · 32.0K views  

> **Posted:** 2026-09-29T13:47:10+00:00  


> **Source Link:** [https://x.com/miki_p1/status/2104930992083317029](https://x.com/miki_p1/status/2104930992083317029)  


> **Visual Context:** A screenshot from GMGN shows a "30D Realized Profit" of "+$1.5M" displayed prominently in a teal box, aligning with the post's reflection on a successful month. Social handles "gmgnai" on X and "gmgn.ai" appear in the top corners, with an invite code "miki" visible at the bottom.  

> 
> "been a good month.

grateful."


### Discussion #14 by @prieto031176
> **Author:** [@prieto031176](https://x.com/prieto031176)  
> **Metrics:** 43 likes · 0 retweets · 2 comments · 16.4K views  

> **Posted:** 2026-09-29T15:04:34+00:00  


> **Source Link:** [https://x.com/prieto031176/status/2104950468602691724](https://x.com/prieto031176/status/2104950468602691724)  


> 
> "Wataa"


### Discussion #15 by @uncledoomer
> **Author:** [@uncledoomer](https://x.com/uncledoomer)  
> **Metrics:** 546 likes · 4 retweets · 19 comments · 16.1K views  

> **Posted:** 2026-09-28T20:16:27+00:00  


> **Source Link:** [https://x.com/uncledoomer/status/2104666567275384960](https://x.com/uncledoomer/status/2104666567275384960)  


> **Visual Context:** A navy blue sweater featuring an American flag and the word "REINDUSTRIALIZE" laid next to Marc Andreessen's "The Techno-Optimist Manifesto" booklet—both arriving in the mail on the same day in a fitting coincidence, as Andreessen's writings champion industrial revival and American technological dominance.  

> 
> "an interesting coincidence that both of these items arrived in my mailbox on the same day"


### Discussion #16 by @ThinkingUSD
> **Author:** [@ThinkingUSD](https://x.com/ThinkingUSD)  
> **Metrics:** 164 likes · 4 retweets · 22 comments · 13.7K views  

> **Posted:** 2026-09-29T19:22:27+00:00  


> **Source Link:** [https://x.com/ThinkingUSD/status/2105015369282810059](https://x.com/ThinkingUSD/status/2105015369282810059)  


> 
> "Keep it simple"


### Discussion #17 by @MollyJongFast
> **Author:** [@MollyJongFast](https://x.com/MollyJongFast)  
> **Metrics:** 175 likes · 28 retweets · 17 comments · 12.2K views  

> **Posted:** 2026-09-29T19:31:20+00:00  


> **Source Link:** [https://x.com/MollyJongFast/status/2105017603878203731](https://x.com/MollyJongFast/status/2105017603878203731)  


> **Visual Context:** A news headline from "Politics & Policy" by Jim VandeHei reads, "Sen. Eric Schmitt is drawing buzz as a possible Vance VP in 2028." The post's "Lololol" reaction appears to mock the speculative pairing of Missouri Senator Eric Schmitt as a potential running mate for Vice President JD Vance in a future presidential bid.  

> 
> "Lololol"


### Discussion #18 by @tswiftstorenews
> **Author:** [@tswiftstorenews](https://x.com/tswiftstorenews)  
> **Metrics:** 215 likes · 6 retweets · 6 comments · 12.1K views  

> **Posted:** 2026-09-29T19:50:58+00:00  


> **Source Link:** [https://x.com/tswiftstorenews/status/2105022545036779564](https://x.com/tswiftstorenews/status/2105022545036779564)  


> 
> "me saying “collections” in 2026 was not on my bingo card. 2024 followers know"


### Discussion #19 by @bratloner
> **Author:** [@bratloner](https://x.com/bratloner)  
> **Metrics:** 512 likes · 27 retweets · 16 comments · 10.6K views  

> **Posted:** 2026-09-29T15:19:15+00:00  


> **Source Link:** [https://x.com/bratloner/status/2104954164010795439](https://x.com/bratloner/status/2104954164010795439)  


> 
> "this is for you"


### Discussion #20 by @Piter_Scheuer
> **Author:** [@Piter_Scheuer](https://x.com/Piter_Scheuer)  
> **Metrics:** 323 likes · 31 retweets · 11 comments · 10.4K views  

> **Posted:** 2026-09-29T12:31:40+00:00  


> **Source Link:** [https://x.com/Piter_Scheuer/status/2104911990510530645](https://x.com/Piter_Scheuer/status/2104911990510530645)  


> 
> "ALERTA"


### Discussion #21 by @camievangelist4
> **Author:** [@camievangelist4](https://x.com/camievangelist4)  
> **Metrics:** 1.2K likes · 20 retweets · 44 comments · 9.6K views  

> **Posted:** 2026-09-29T17:57:25+00:00  


> **Source Link:** [https://x.com/camievangelist4/status/2104993967867838619](https://x.com/camievangelist4/status/2104993967867838619)  


> 
> "Wishing you a happy Tuesday"


### Discussion #22 by @TomiLahren
> **Author:** [@TomiLahren](https://x.com/TomiLahren)  
> **Metrics:** 28 likes · 4 retweets · 5 comments · 4.9K views  

> **Posted:** 2026-09-29T19:41:31+00:00  


> **Source Link:** [https://x.com/TomiLahren/status/2105020163687088321](https://x.com/TomiLahren/status/2105020163687088321)  


> 
> "Um?"


### Discussion #23 by @inysains
> **Author:** [@inysains](https://x.com/inysains)  
> **Metrics:** 176 likes · 21 retweets · 0 comments · 3.2K views  

> **Posted:** 2026-09-29T14:24:30+00:00  


> **Source Link:** [https://x.com/inysains/status/2104940386238288088](https://x.com/inysains/status/2104940386238288088)  


> **Visual Context:** The image shows a young woman with long brown hair wearing a white dress with a plunging neckline, sitting on stage with her hands folded. The accompanying text "ugh" and the two X.com status links suggest the post is expressing frustration or exasperation, possibly related to the event or person pictured.  

> 
> "ugh 
x.com/inysains/statu
… 
x.com/inysains/statu
…"


### Discussion #24 by @alshreefahmaad
> **Author:** [@alshreefahmaad](https://x.com/alshreefahmaad)  
> **Metrics:** 143 likes · 5 retweets · 18 comments · 2.7K views  

> **Posted:** 2026-09-29T17:24:15+00:00  


> **Source Link:** [https://x.com/alshreefahmaad/status/2104985620397559913](https://x.com/alshreefahmaad/status/2104985620397559913)  


> 
> "It’s become a hassle for you for 15 days."


### Discussion #25 by @outrodhk
> **Author:** [@outrodhk](https://x.com/outrodhk)  
> **Metrics:** 472 likes · 50 retweets · 0 comments · 2.7K views  

> **Posted:** 2026-09-29T15:11:17+00:00  


> **Source Link:** [https://x.com/outrodhk/status/2104952160605900801](https://x.com/outrodhk/status/2104952160605900801)  


> 
> "she looks like a dream"


### Discussion #26 by @jazminejanay
> **Author:** [@jazminejanay](https://x.com/jazminejanay)  
> **Metrics:** 126 likes · 3 retweets · 0 comments · 2.2K views  

> **Posted:** 2026-09-29T18:14:36+00:00  


> **Source Link:** [https://x.com/jazminejanay/status/2104998293759803493](https://x.com/jazminejanay/status/2104998293759803493)  


> 
> "Happy tuesdaaaay"


### Discussion #27 by @Yezzzan9
> **Author:** [@Yezzzan9](https://x.com/Yezzzan9)  
> **Metrics:** 9 likes · 0 retweets · 1 comments · 2.1K views  

> **Posted:** 2026-09-29T17:58:04+00:00  


> **Source Link:** [https://x.com/Yezzzan9/status/2104994133261873397](https://x.com/Yezzzan9/status/2104994133261873397)  


> 
> "음 ㅇㅋ
2시19분에 숙소왓고
56분에 누웟구나"


### Discussion #28 by @minapolized
> **Author:** [@minapolized](https://x.com/minapolized)  
> **Metrics:** 199 likes · 31 retweets · 1 comments · 1.9K views  

> **Posted:** 2026-09-29T18:14:14+00:00  


> **Source Link:** [https://x.com/minapolized/status/2104998201921282104](https://x.com/minapolized/status/2104998201921282104)  


> **Visual Context:** A stylish young woman with long black hair and rectangular sunglasses stands in what appears to be an airport or public terminal, wearing a white, black, and green racing-style jacket featuring "Thunder Racing" text and various sponsor logos including Goodyear. She holds a smartphone in her hand while looking off to the side, fitting the casual "Ok wait -" caption that suggests she's pausing or noticing something interesting.  

> 
> "Ok wait -"


### Discussion #29 by @TimOnSol_
> **Author:** [@TimOnSol_](https://x.com/TimOnSol_)  
> **Metrics:** 120 likes · 72 retweets · 120 comments · 1.8K views  

> **Posted:** 2026-09-29T18:54:35+00:00  


> **Source Link:** [https://x.com/TimOnSol_/status/2105008353768288386](https://x.com/TimOnSol_/status/2105008353768288386)  


> 
> "50$ giveaway

follow 
@Shipd_
 
max engage on quote

post proofs in comment
winner in 24 hours good luck !"


### Discussion #30 by @saidatruther
> **Author:** [@saidatruther](https://x.com/saidatruther)  
> **Metrics:** 81 likes · 6 retweets · 2 comments · 1.4K views  

> **Posted:** 2026-09-29T17:05:15+00:00  


> **Source Link:** [https://x.com/saidatruther/status/2104980837750153285](https://x.com/saidatruther/status/2104980837750153285)  


> **Visual Context:** Two young women with long hair and headset microphones stand together on a pastel-colored stage set featuring a neon "Alca..." sign (likely "Alcatraz") in the background, wearing ornate floral-patterned outfits typical of a Korean music show performance. The "honorable mention" caption suggests they are being recognized for a notable moment, likely their striking styling or memorable stage presence.  

> 
> "honorable mention"


### Discussion #31 by @TownShifnal
> **Author:** [@TownShifnal](https://x.com/TownShifnal)  
> **Metrics:** 3 likes · 1 retweets · 0 comments · 1.4K views  

> **Posted:** 2026-09-29T18:44:18+00:00  


> **Source Link:** [https://x.com/TownShifnal/status/2105005767699103810](https://x.com/TownShifnal/status/2105005767699103810)  


> 
> "Let’s gooo"


### Discussion #32 by @DeeZe
> **Author:** [@DeeZe](https://x.com/DeeZe)  
> **Metrics:** 20 likes · 0 retweets · 6 comments · 1.3K views  

> **Posted:** 2026-09-29T19:42:52+00:00  


> **Source Link:** [https://x.com/DeeZe/status/2105020506764124580](https://x.com/DeeZe/status/2105020506764124580)  


> **Visual Context:** A PSA-graded Gem Mint 10 2025 Riftbound OGN EN "Teemo Worlds Bundle" card (#263a) featuring the artwork of the League of Legends character Teemo with the text "Swift Scout," celebrating another addition to the trading card collection.  

> 
> "We do a little checking more cardboard off the list"


### Discussion #33 by @ihporr
> **Author:** [@ihporr](https://x.com/ihporr)  
> **Metrics:** 152 likes · 51 retweets · 2 comments · 1.3K views  

> **Posted:** 2026-09-29T19:15:15+00:00  


> **Source Link:** [https://x.com/ihporr/status/2105013555460456628](https://x.com/ihporr/status/2105013555460456628)  


> 
> "OMG so much, sis"


### Discussion #34 by @jonathan_wilke
> **Author:** [@jonathan_wilke](https://x.com/jonathan_wilke)  
> **Metrics:** 11 likes · 2 retweets · 4 comments · 1.3K views  

> **Posted:** 2026-09-29T19:13:13+00:00  


> **Source Link:** [https://x.com/jonathan_wilke/status/2105013043432169781](https://x.com/jonathan_wilke/status/2105013043432169781)  


> **Visual Context:** A young man with tousled brown hair takes a selfie from a low angle, wearing an unbuttoned pink dress shirt while working on a silver Apple laptop. The caption "me at 21" pairs with his youthful appearance and the casual yet polished look of his styled hair and partially open shirt, suggesting a moment of relaxed confidence during a typical workday or study session.  

> 
> "me at 21"


### Discussion #35 by @whizz_xD
> **Author:** [@whizz_xD](https://x.com/whizz_xD)  
> **Metrics:** 71 likes · 4 retweets · 49 comments · 1.2K views  

> **Posted:** 2026-09-29T19:12:12+00:00  


> **Source Link:** [https://x.com/whizz_xD/status/2105012787684499812](https://x.com/whizz_xD/status/2105012787684499812)  


> 
> "hey"


### Discussion #36 by @reddit
> **Author:** [@reddit](https://x.com/reddit)  
> **Metrics:** 12 likes · 0 retweets · 2 comments · 1.2K views  

> **Posted:** 2026-09-28T15:55:29.732000+00:00  



> 
> "You’ve seen me.

This started happening to me a few days ago, and I don’t know what to do. I made my way back to my apartment complex from the gas station. It’s close, so I always walk there. As I approached the building, I got a strong urge to look up. I saw rows and rows of windows. It was nighttime, so all the curtains were closed except for one. There was a person standing in the window. They were on the top floor, so from where I stood, they looked like nothing more than a shadow. I couldn’t make out anything about them, but for some reason, my body filled with dread the moment I saw them. I wanted to look away, but I couldn’t. I could feel that something was wrong. I knew it was staring at me, but how could I possibly know that?
Finally, I managed to tear my gaze away and walk inside. Luckily, I lived on the bottom floor, so I didn’t have to go anywhere near that window."


### Discussion #37 by @lilaalux
> **Author:** [@lilaalux](https://x.com/lilaalux)  
> **Metrics:** 15 likes · 63 retweets · 3 comments · 1.2K views  

> **Posted:** 2026-09-29T17:52:37+00:00  


> **Source Link:** [https://x.com/lilaalux/status/2104992758972735718](https://x.com/lilaalux/status/2104992758972735718)  


> 
> "if u wanna ,check comments"


### Discussion #38 by @kingbtc
> **Author:** [@kingbtc](https://x.com/kingbtc)  
> **Metrics:** 39 likes · 0 retweets · 8 comments · 1.1K views  

> **Posted:** 2026-09-29T19:35:18+00:00  


> **Source Link:** [https://x.com/kingbtc/status/2105018601182777636](https://x.com/kingbtc/status/2105018601182777636)  


> **Visual Context:** A gas stove with a blue flame under a pot covered with plastic wrap, a small ceramic dish with melted butter, and a cast iron skillet containing cooking bacon.  

> 
> "made carbonara for the first time

gonna master the process this week"


### Discussion #39 by @LangmanVince
> **Author:** [@LangmanVince](https://x.com/LangmanVince)  
> **Metrics:** 12 likes · 6 retweets · 2 comments · 1.1K views  

> **Posted:** 2026-09-29T19:37:55+00:00  


> **Source Link:** [https://x.com/LangmanVince/status/2105019260518932780](https://x.com/LangmanVince/status/2105019260518932780)  


> 
> "These people are truly demonic"


### Discussion #40 by @0x_vertigo
> **Author:** [@0x_vertigo](https://x.com/0x_vertigo)  
> **Metrics:** 64 likes · 6 retweets · 11 comments · 1.0K views  

> **Posted:** 2026-09-29T13:08:20+00:00  


> **Source Link:** [https://x.com/0x_vertigo/status/2104921218457505935](https://x.com/0x_vertigo/status/2104921218457505935)  


> 
> "A lot of growth probably happens once you realize no one is coming to save you."


### Discussion #41 by @TheLeoTerrell
> **Author:** [@TheLeoTerrell](https://x.com/TheLeoTerrell)  
> **Metrics:** 1 likes · 0 retweets · 0 comments · 908 views  

> **Posted:** 2026-09-29T19:55:59+00:00  


> **Source Link:** [https://x.com/TheLeoTerrell/status/2105023806779633899](https://x.com/TheLeoTerrell/status/2105023806779633899)  


> 
> "Please watch and RT!"


### Discussion #42 by @giyomi05122
> **Author:** [@giyomi05122](https://x.com/giyomi05122)  
> **Metrics:** 23 likes · 0 retweets · 0 comments · 897 views  

> **Posted:** 2026-09-29T17:46:31+00:00  


> **Source Link:** [https://x.com/giyomi05122/status/2104991226131005583](https://x.com/giyomi05122/status/2104991226131005583)  


> **Visual Context:** A person with dark hair in a ponytail takes a mirror selfie with a smartphone while riding in an elevator, wearing a black t-shirt and carrying a bag.  

> 
> "정보 : 김둔근은 굉장히 온순해보이게 생겼다."


### Discussion #43 by @Alice69444
> **Author:** [@Alice69444](https://x.com/Alice69444)  
> **Metrics:** 28 likes · 0 retweets · 1 comments · 828 views  

> **Posted:** 2026-09-29T19:10:03+00:00  


> **Source Link:** [https://x.com/Alice69444/status/2105012245654618518](https://x.com/Alice69444/status/2105012245654618518)  


> **Visual Context:** [caption-failed: flagged sensitive]  

> 
> "This thong is way too cute"


### Discussion #44 by @hotelsss38
> **Author:** [@hotelsss38](https://x.com/hotelsss38)  
> **Metrics:** 16 likes · 1 retweets · 8 comments · 791 views  

> **Posted:** 2026-09-29T18:01:43+00:00  


> **Source Link:** [https://x.com/hotelsss38/status/2104995049792844184](https://x.com/hotelsss38/status/2104995049792844184)  


> 
> "Beyşehir Seydişehir"


### Discussion #45 by @thatssoolaurenn
> **Author:** [@thatssoolaurenn](https://x.com/thatssoolaurenn)  
> **Metrics:** 75 likes · 3 retweets · 8 comments · 776 views  

> **Posted:** 2026-09-29T19:28:28+00:00  


> **Source Link:** [https://x.com/thatssoolaurenn/status/2105016879806828683](https://x.com/thatssoolaurenn/status/2105016879806828683)  


> 
> "Do you like the pink?"


### Discussion #46 by @notbshadow
> **Author:** [@notbshadow](https://x.com/notbshadow)  
> **Metrics:** 15 likes · 3 retweets · 0 comments · 737 views  

> **Posted:** 2026-09-29T19:10:38+00:00  


> **Source Link:** [https://x.com/notbshadow/status/2105012392874885613](https://x.com/notbshadow/status/2105012392874885613)  


> 
> "You cannot lose.. WHEN IS YOUR TIME TO WIN!"


### Discussion #47 by @HoneySweetSoles
> **Author:** [@HoneySweetSoles](https://x.com/HoneySweetSoles)  
> **Metrics:** 16 likes · 3 retweets · 0 comments · 734 views  

> **Posted:** 2026-09-29T18:39:22+00:00  


> **Source Link:** [https://x.com/HoneySweetSoles/status/2105004525883142532](https://x.com/HoneySweetSoles/status/2105004525883142532)  


> 
> "POV: I made you oil up my feet. Now I’m ignoring you while working, but I catch you staring"


### Discussion #48 by @LuminousSANA
> **Author:** [@LuminousSANA](https://x.com/LuminousSANA)  
> **Metrics:** 87 likes · 5 retweets · 0 comments · 724 views  

> **Posted:** 2026-09-29T14:17:46+00:00  


> **Source Link:** [https://x.com/LuminousSANA/status/2104938690707632464](https://x.com/LuminousSANA/status/2104938690707632464)  


> 
> "SUNKISSED BABYGIRL"


### Discussion #49 by @wildestmind
> **Author:** [@wildestmind](https://x.com/wildestmind)  
> **Metrics:** 10 likes · 0 retweets · 0 comments · 712 views  

> **Posted:** 2026-09-29T19:02:13+00:00  


> **Source Link:** [https://x.com/wildestmind/status/2105010274596159685](https://x.com/wildestmind/status/2105010274596159685)  


> 
> "IM IN LOVEEE"


### Discussion #50 by @billyfantasie
> **Author:** [@billyfantasie](https://x.com/billyfantasie)  
> **Metrics:** 32 likes · 2 retweets · 3 comments · 703 views  

> **Posted:** 2026-09-29T17:50:56+00:00  


> **Source Link:** [https://x.com/billyfantasie/status/2104992337818522084](https://x.com/billyfantasie/status/2104992337818522084)  


> 
> "Red or black? Catch me live in the studio #latex #domina #femdom #bdsm #fetisch #saarbrücken"


### Discussion #51 by @dantevlr1
> **Author:** [@dantevlr1](https://x.com/dantevlr1)  
> **Metrics:** 12 likes · 3 retweets · 0 comments · 695 views  

> **Posted:** 2026-09-29T18:37:42+00:00  


> **Source Link:** [https://x.com/dantevlr1/status/2105004103713656906](https://x.com/dantevlr1/status/2105004103713656906)  


> 
> "."


### Discussion #52 by @ChenotSony9nuq
> **Author:** [@ChenotSony9nuq](https://x.com/ChenotSony9nuq)  
> **Metrics:** 33 likes · 32 retweets · 0 comments · 691 views  

> **Posted:** 2026-09-29T18:38:15+00:00  


> **Source Link:** [https://x.com/ChenotSony9nuq/status/2105004244717928626](https://x.com/ChenotSony9nuq/status/2105004244717928626)  


> 
> "video.twimg.systems/amplify_video/
…
video.twimg.systems/ext_tw_video/7
…"


### Discussion #53 by @chaosx_jpeg
> **Author:** [@chaosx_jpeg](https://x.com/chaosx_jpeg)  
> **Metrics:** 7 likes · 1 retweets · 0 comments · 689 views  

> **Posted:** 2026-09-29T19:06:00+00:00  


> **Source Link:** [https://x.com/chaosx_jpeg/status/2105011225528815629](https://x.com/chaosx_jpeg/status/2105011225528815629)  


> 
> "when u steal a tweet and it ends up doing better than the original"


### Discussion #54 by @lyohbunii
> **Author:** [@lyohbunii](https://x.com/lyohbunii)  
> **Metrics:** 12 likes · 1 retweets · 2 comments · 684 views  

> **Posted:** 2026-09-29T18:39:08+00:00  


> **Source Link:** [https://x.com/lyohbunii/status/2105004465367446010](https://x.com/lyohbunii/status/2105004465367446010)  


> 
> "me n 
@miffyisy
 ₍^. .^₎⟆"


### Discussion #55 by @FoutsLeadership
> **Author:** [@FoutsLeadership](https://x.com/FoutsLeadership)  
> **Metrics:** 8 likes · 0 retweets · 1 comments · 680 views  

> **Posted:** 2026-09-29T19:17:51+00:00  


> **Source Link:** [https://x.com/FoutsLeadership/status/2105014207599247780](https://x.com/FoutsLeadership/status/2105014207599247780)  


> 
> "Dinner in 20 minutes. One piece of equipment. Beckett makes this himself.
@RealGoodFoods
 pineapple teriyaki meatballs, bell pepper, pineapple, soy sauce, sesame oil in one compartment. Chicken broth rice in the other. 
@SharkNinja
 multipot handles both at the same time.

480"


### Discussion #56 by @EMBIAGI1
> **Author:** [@EMBIAGI1](https://x.com/EMBIAGI1)  
> **Metrics:** 14 likes · 0 retweets · 1 comments · 677 views  

> **Posted:** 2026-09-29T18:49:21+00:00  


> **Source Link:** [https://x.com/EMBIAGI1/status/2105007039042785661](https://x.com/EMBIAGI1/status/2105007039042785661)  


> 
> "Well done 
@easya_app
 @dom_kwok
 @kwok_phil"


### Discussion #57 by @joanmargall
> **Author:** [@joanmargall](https://x.com/joanmargall)  
> **Metrics:** 5 likes · 0 retweets · 2 comments · 637 views  

> **Posted:** 2026-09-29T18:25:18+00:00  


> **Source Link:** [https://x.com/joanmargall/status/2105000983965086204](https://x.com/joanmargall/status/2105000983965086204)  


> 
> "Ha sonat quan ja havia passat la tempesta #jugadamestra"


### Discussion #58 by @TheCut
> **Author:** [@TheCut](https://x.com/TheCut)  
> **Metrics:** 1 likes · 0 retweets · 0 comments · 614 views  

> **Posted:** 2026-09-29T19:29:50+00:00  


> **Source Link:** [https://x.com/TheCut/status/2105017223295443281](https://x.com/TheCut/status/2105017223295443281)  


> 
> "Shopping for vintage clothing online is a hard skill to master. Luckily, stylist and longtime vintage lover Allison Bornstein is here to help. Click to read her tips and tricks for success."


### Discussion #59 by @krisspax
> **Author:** [@krisspax](https://x.com/krisspax)  
> **Metrics:** 15 likes · 0 retweets · 3 comments · 611 views  

> **Posted:** 2026-09-29T18:54:53+00:00  


> **Source Link:** [https://x.com/krisspax/status/2105008427940692370](https://x.com/krisspax/status/2105008427940692370)  


> **Visual Context:** A blue BMW convertible is parked on a brick plaza near a beach, with palm trees and an umbrella visible in the background.  

> 
> "We’ve rented a BMW M4 Competition for the day!"


### Discussion #60 by @bitchyboy6
> **Author:** [@bitchyboy6](https://x.com/bitchyboy6)  
> **Metrics:** 17 likes · 7 retweets · 5 comments · 610 views  

> **Posted:** 2026-09-29T19:12:39+00:00  


> **Source Link:** [https://x.com/bitchyboy6/status/2105012902914883701](https://x.com/bitchyboy6/status/2105012902914883701)  


> 
> "If nobody sent you money today, like this tweet 

And pick a number from $500 - $2k silent sends"


### Discussion #61 by @azsweetheart013
> **Author:** [@azsweetheart013](https://x.com/azsweetheart013)  
> **Metrics:** 2 likes · 1 retweets · 0 comments · 609 views  

> **Posted:** 2026-09-29T19:26:01+00:00  


> **Source Link:** [https://x.com/azsweetheart013/status/2105016266398511163](https://x.com/azsweetheart013/status/2105016266398511163)  


> 
> "By choice"


### Discussion #62 by @Cloeqnx
> **Author:** [@Cloeqnx](https://x.com/Cloeqnx)  
> **Metrics:** 5 likes · 0 retweets · 2 comments · 595 views  

> **Posted:** 2026-09-29T18:47:41+00:00  


> **Source Link:** [https://x.com/Cloeqnx/status/2105006619285508289](https://x.com/Cloeqnx/status/2105006619285508289)  


> 
> "Who’s active rn rn"


### Discussion #63 by @jasonllevin
> **Author:** [@jasonllevin](https://x.com/jasonllevin)  
> **Metrics:** 44 likes · 10 retweets · 6 comments · 588 views  

> **Posted:** 2026-09-29T17:31:22+00:00  


> **Source Link:** [https://x.com/jasonllevin/status/2104987411990167555](https://x.com/jasonllevin/status/2104987411990167555)  


> **Visual Context:** A muscular, bearded man in black athletic wear smiles and flexes his arm while sitting on a large sea turtle on a sandy beach at night.  

> 
> "Vile and Disgusting!"


### Discussion #64 by @NikolaBrussels
> **Author:** [@NikolaBrussels](https://x.com/NikolaBrussels)  
> **Metrics:** 6 likes · 2 retweets · 0 comments · 569 views  

> **Posted:** 2026-09-29T18:08:17+00:00  


> **Source Link:** [https://x.com/NikolaBrussels/status/2104996701719368013](https://x.com/NikolaBrussels/status/2104996701719368013)  


> 
> "Anyone else?"


### Discussion #65 by @skylartwx
> **Author:** [@skylartwx](https://x.com/skylartwx)  
> **Metrics:** 46 likes · 1 retweets · 1 comments · 562 views  

> **Posted:** 2026-09-29T19:20:40+00:00  


> **Source Link:** [https://x.com/skylartwx/status/2105014919532044508](https://x.com/skylartwx/status/2105014919532044508)  


> 
> "eyes are up here"


### Discussion #66 by @RPMarks
> **Author:** [@RPMarks](https://x.com/RPMarks)  
> **Metrics:** 26 likes · 1 retweets · 0 comments · 552 views  

> **Posted:** 2026-09-28T21:01:51+00:00  


> **Source Link:** [https://x.com/RPMarks/status/2104677993750913044](https://x.com/RPMarks/status/2104677993750913044)  


> **Visual Context:** A train yard or maintenance depot features several parked trains alongside a teal industrial building, with a yellow van and a small white car on the access road below.  

> 
> "Aylesbury TMD, 21/09/00. From left to right are class 122 Sandite car 960015, former Scotrail unit 117306 (spares donor), Chilten Turbo 165022 and disused Sandite unit 960002 (later resurrected as passenger unit 121020). Also a Ford Scorpio & an Amey Rail Transit for good measure"


### Discussion #67 by @HouseOfDouleur
> **Author:** [@HouseOfDouleur](https://x.com/HouseOfDouleur)  
> **Metrics:** 1 likes · 0 retweets · 1 comments · 544 views  

> **Posted:** 2026-09-29T19:19:28+00:00  


> **Source Link:** [https://x.com/HouseOfDouleur/status/2105014614983655885](https://x.com/HouseOfDouleur/status/2105014614983655885)  


> 
> "Plotting my winter escape…"


### Discussion #68 by @jrxcket
> **Author:** [@jrxcket](https://x.com/jrxcket)  
> **Metrics:** 6 likes · 0 retweets · 2 comments · 540 views  

> **Posted:** 2026-09-29T19:18:36+00:00  


> **Source Link:** [https://x.com/jrxcket/status/2105014396342731227](https://x.com/jrxcket/status/2105014396342731227)  


> 
> "God damn, these are sick!! Can someone speed these up to real time??"


### Discussion #69 by @Georgieekiss
> **Author:** [@Georgieekiss](https://x.com/Georgieekiss)  
> **Metrics:** 8 likes · 64 retweets · 2 comments · 527 views  

> **Posted:** 2026-09-29T18:55:55+00:00  


> **Source Link:** [https://x.com/Georgieekiss/status/2105008690785112261](https://x.com/Georgieekiss/status/2105008690785112261)  


> 
> "I'm having hard time to find the right size, does it fit?"


### Discussion #70 by @JoelOptimist1
> **Author:** [@JoelOptimist1](https://x.com/JoelOptimist1)  
> **Metrics:** 1 likes · 1 retweets · 0 comments · 516 views  

> **Posted:** 2026-09-29T16:27:45+00:00  


> **Source Link:** [https://x.com/JoelOptimist1/status/2104971403556507937](https://x.com/JoelOptimist1/status/2104971403556507937)  


> 
> "You didn’t just post a video; you brought an idea to life."


### Discussion #71 by @fuukattino
> **Author:** [@fuukattino](https://x.com/fuukattino)  
> **Metrics:** 6 likes · 0 retweets · 0 comments · 511 views  

> **Posted:** 2026-09-29T18:21:57+00:00  


> **Source Link:** [https://x.com/fuukattino/status/2105000143514935548](https://x.com/fuukattino/status/2105000143514935548)  


> 
> "mcgay's little concubine is now a genuine figure in my organization"


### Discussion #72 by @whotfisjovana
> **Author:** [@whotfisjovana](https://x.com/whotfisjovana)  
> **Metrics:** 10 likes · 0 retweets · 4 comments · 510 views  

> **Posted:** 2026-09-29T19:38:14+00:00  


> **Source Link:** [https://x.com/whotfisjovana/status/2105019337551831222](https://x.com/whotfisjovana/status/2105019337551831222)  


> 
> "is anybody gonna wish me a happy half bday"


### Discussion #73 by @Meysvm
> **Author:** [@Meysvm](https://x.com/Meysvm)  
> **Metrics:** 15 likes · 1 retweets · 1 comments · 506 views  

> **Posted:** 2026-09-29T18:46:46+00:00  


> **Source Link:** [https://x.com/Meysvm/status/2105006385465541113](https://x.com/Meysvm/status/2105006385465541113)  


> 
> "Oh  
@ArchanNair
 @MuoriField"


### Discussion #74 by @mandocharts
> **Author:** [@mandocharts](https://x.com/mandocharts)  
> **Metrics:** 11 likes · 0 retweets · 1 comments · 498 views  

> **Posted:** 2026-09-29T19:01:02+00:00  


> **Source Link:** [https://x.com/mandocharts/status/2105009977593360719](https://x.com/mandocharts/status/2105009977593360719)  


> **Visual Context:** Two dark bowls of food sit on a wooden table, one containing raw beef with an egg yolk and the other a creamy dish with salmon and avocado, alongside an empty black plate with chopsticks.  

> 
> "yummy"


### Discussion #75 by @dailygawon
> **Author:** [@dailygawon](https://x.com/dailygawon)  
> **Metrics:** 32 likes · 7 retweets · 0 comments · 484 views  

> **Posted:** 2026-09-29T19:39:00+00:00  


> **Source Link:** [https://x.com/dailygawon/status/2105019531622052200](https://x.com/dailygawon/status/2105019531622052200)  


> 
> "crazy side profile"


### Discussion #76 by @ExoticElena1
> **Author:** [@ExoticElena1](https://x.com/ExoticElena1)  
> **Metrics:** 15 likes · 0 retweets · 1 comments · 463 views  

> **Posted:** 2026-09-29T18:11:36+00:00  


> **Source Link:** [https://x.com/ExoticElena1/status/2104997538734440620](https://x.com/ExoticElena1/status/2104997538734440620)  


> **Visual Context:** A woman takes a mirror selfie wearing a black zip-up jacket with gold trim over a white top, giving a middle finger gesture, with a visible tattoo on her chest.  

> 
> "Wayy hotter than wifey"


### Discussion #77 by @JaydenLotto
> **Author:** [@JaydenLotto](https://x.com/JaydenLotto)  
> **Metrics:** 18 likes · 1 retweets · 2 comments · 462 views  

> **Posted:** 2026-09-29T18:05:26+00:00  


> **Source Link:** [https://x.com/JaydenLotto/status/2104995984585453632](https://x.com/JaydenLotto/status/2104995984585453632)  


> 
> "I was so busy today I nearly forgot it's #TittyTuesday"


### Discussion #78 by @OttoSuwen
> **Author:** [@OttoSuwen](https://x.com/OttoSuwen)  
> **Metrics:** 0 likes · 0 retweets · 0 comments · 462 views  

> **Posted:** 2026-09-29T19:54:51+00:00  


> **Source Link:** [https://x.com/OttoSuwen/status/2105023519344255116](https://x.com/OttoSuwen/status/2105023519344255116)  


> 
> "People are probably going to end up super beared up after September"


### Discussion #79 by @wedtm
> **Author:** [@wedtm](https://x.com/wedtm)  
> **Metrics:** 2 likes · 0 retweets · 1 comments · 458 views  

> **Posted:** 2026-09-29T18:27:04+00:00  


> **Source Link:** [https://x.com/wedtm/status/2105001429853229058](https://x.com/wedtm/status/2105001429853229058)  


> **Visual Context:** A dark notification pop-up displays 'Dots aren't available in your region yet' with a 'Got it' button.  

> 
> "*miles had never seen such bullshit*"


### Discussion #80 by @kaur_amoldeep
> **Author:** [@kaur_amoldeep](https://x.com/kaur_amoldeep)  
> **Metrics:** 5 likes · 12 retweets · 0 comments · 444 views  

> **Posted:** 2026-09-29T18:00:55+00:00  


> **Source Link:** [https://x.com/kaur_amoldeep/status/2104994849166434399](https://x.com/kaur_amoldeep/status/2104994849166434399)  


> 
> "video5.goplay.diy/otaWNtW.mp4
cdn5.goplay.diy/VdiujnY.mp4"


### Discussion #81 by @Abe_rayado_7
> **Author:** [@Abe_rayado_7](https://x.com/Abe_rayado_7)  
> **Metrics:** 29 likes · 0 retweets · 2 comments · 440 views  

> **Posted:** 2026-09-29T14:19:56+00:00  


> **Source Link:** [https://x.com/Abe_rayado_7/status/2104939236587712890](https://x.com/Abe_rayado_7/status/2104939236587712890)  


> **Visual Context:** A woman with long black hair poses in a sparkly black strapless top and long black gloves against a wood-paneled wall.  

> 
> "What the hell is wrong with her"


### Discussion #82 by @ylll_h
> **Author:** [@ylll_h](https://x.com/ylll_h)  
> **Metrics:** 29 likes · 16 retweets · 57 comments · 439 views  

> **Posted:** 2026-09-29T19:04:22+00:00  


> **Source Link:** [https://x.com/ylll_h/status/2105010814885433357](https://x.com/ylll_h/status/2105010814885433357)  


> **Visual Context:** Silhouetted arms rise in a dark crowd, each hand holding up a glowing blue badge with a white checkmark, suggesting an online or digital approval.  

> 
> "If you need 2k followers 

Just Say Indeed 

I will boost your page"


### Discussion #83 by @JoelOptimist1
> **Author:** [@JoelOptimist1](https://x.com/JoelOptimist1)  
> **Metrics:** 1 likes · 1 retweets · 0 comments · 439 views  

> **Posted:** 2026-09-29T16:27:40+00:00  


> **Source Link:** [https://x.com/JoelOptimist1/status/2104971380437422533](https://x.com/JoelOptimist1/status/2104971380437422533)  


> 
> "Keep creating and experimenting. Your next idea could be even more interesting."


### Discussion #84 by @clerpatriot
> **Author:** [@clerpatriot](https://x.com/clerpatriot)  
> **Metrics:** 16 likes · 3 retweets · 8 comments · 438 views  

> **Posted:** 2026-09-29T19:39:43+00:00  


> **Source Link:** [https://x.com/clerpatriot/status/2105019712199602602](https://x.com/clerpatriot/status/2105019712199602602)  


> 
> "Ummmmm……."


### Discussion #85 by @ta_su1san
> **Author:** [@ta_su1san](https://x.com/ta_su1san)  
> **Metrics:** 1 likes · 0 retweets · 1 comments · 438 views  

> **Posted:** 2026-09-29T18:14:53+00:00  


> **Source Link:** [https://x.com/ta_su1san/status/2104998364379259143](https://x.com/ta_su1san/status/2104998364379259143)  


> 
> "起きたら13分前に終わってた"


### Discussion #86 by @meoowstical
> **Author:** [@meoowstical](https://x.com/meoowstical)  
> **Metrics:** 18 likes · 0 retweets · 3 comments · 434 views  

> **Posted:** 2026-09-29T18:16:36+00:00  


> **Source Link:** [https://x.com/meoowstical/status/2104998796077797509](https://x.com/meoowstical/status/2104998796077797509)  


> 
> "Tummy yummy ๑ᵔ⤙ᵔ๑"


### Discussion #87 by @MarkHeath45
> **Author:** [@MarkHeath45](https://x.com/MarkHeath45)  
> **Metrics:** 13 likes · 2 retweets · 0 comments · 430 views  

> **Posted:** 2026-09-29T19:40:04+00:00  


> **Source Link:** [https://x.com/MarkHeath45/status/2105019799592128731](https://x.com/MarkHeath45/status/2105019799592128731)  


> **Visual Context:** A Facebook post by Mark Heath (6 Sep) stating: 'You may not like what I say, but i have every right to say it! Was my defence when the establishment wanted me in prison after Southport, and acquitted of all charges!! And on the flip side, i may not agree with what YOU say but I will defend to the death your right to say it!'  

> 
> "Simple!"


### Discussion #88 by @rezoundous
> **Author:** [@rezoundous](https://x.com/rezoundous)  
> **Metrics:** 11 likes · 0 retweets · 1 comments · 430 views  

> **Posted:** 2026-09-29T19:35:00+00:00  


> **Source Link:** [https://x.com/rezoundous/status/2105018525387530240](https://x.com/rezoundous/status/2105018525387530240)  


> 
> "resets have always been a band-aid.."


### Discussion #89 by @james406
> **Author:** [@james406](https://x.com/james406)  
> **Metrics:** 8 likes · 0 retweets · 0 comments · 422 views  

> **Posted:** 2026-09-29T19:01:31+00:00  


> **Source Link:** [https://x.com/james406/status/2105010098456113303](https://x.com/james406/status/2105010098456113303)  


> 
> "never give up

caesar spent almost 2,000 years working on the perfect side dish before he invented the caesar salad

keep going"


### Discussion #90 by @Bhaveshlivelife
> **Author:** [@Bhaveshlivelife](https://x.com/Bhaveshlivelife)  
> **Metrics:** 4 likes · 0 retweets · 1 comments · 409 views  

> **Posted:** 2026-09-29T15:21:54+00:00  


> **Source Link:** [https://x.com/Bhaveshlivelife/status/2104954831731589440](https://x.com/Bhaveshlivelife/status/2104954831731589440)  


> 
> "Uncle came for the event, but apparently the real event was happening somewhere else."


### Discussion #91 by @MrPotatoHeadUSA
> **Author:** [@MrPotatoHeadUSA](https://x.com/MrPotatoHeadUSA)  
> **Metrics:** 7 likes · 2 retweets · 1 comments · 405 views  

> **Posted:** 2026-09-29T19:00:00+00:00  


> **Source Link:** [https://x.com/MrPotatoHeadUSA/status/2105009716719968647](https://x.com/MrPotatoHeadUSA/status/2105009716719968647)  


> 
> "You think he thinks he’s just a weird looking dog?"


### Discussion #92 by @BobbyThakkar
> **Author:** [@BobbyThakkar](https://x.com/BobbyThakkar)  
> **Metrics:** 13 likes · 1 retweets · 4 comments · 402 views  

> **Posted:** 2026-09-29T19:36:17+00:00  


> **Source Link:** [https://x.com/BobbyThakkar/status/2105018848801943855](https://x.com/BobbyThakkar/status/2105018848801943855)  


> 
> "should i start vlogging all of our projects at 
@propagandabuild"


### Discussion #93 by @uug2_chinatsu
> **Author:** [@uug2_chinatsu](https://x.com/uug2_chinatsu)  
> **Metrics:** 6 likes · 2 retweets · 0 comments · 399 views  

> **Posted:** 2026-09-29T19:28:48+00:00  


> **Source Link:** [https://x.com/uug2_chinatsu/status/2105016963877785815](https://x.com/uug2_chinatsu/status/2105016963877785815)  


> 
> "instagram.com/stories/chinat
…"


### Discussion #94 by @holluart
> **Author:** [@holluart](https://x.com/holluart)  
> **Metrics:** 48 likes · 1 retweets · 46 comments · 396 views  

> **Posted:** 2026-09-29T17:18:25+00:00  


> **Source Link:** [https://x.com/holluart/status/2104984152655167707](https://x.com/holluart/status/2104984152655167707)  


> 
> "GN Amigos
The day's over, hope you achieved something great today, tomorrow will def be better, rest up now..."


### Discussion #95 by @veludovermelhoo
> **Author:** [@veludovermelhoo](https://x.com/veludovermelhoo)  
> **Metrics:** 10 likes · 0 retweets · 3 comments · 383 views  

> **Posted:** 2026-09-29T19:30:59+00:00  


> **Source Link:** [https://x.com/veludovermelhoo/status/2105017516716081461](https://x.com/veludovermelhoo/status/2105017516716081461)  


> **Visual Context:** A WhatsApp group info screen for 'BTS Arirang Tour SP - Setor Calçada 3' written in Portuguese, containing group rules for BTS fans (ARMYs), created on 16/05/2026 with 457+ members.  

> 
> "setor calçada 3"


### Discussion #96 by @hilalisevenbiri
> **Author:** [@hilalisevenbiri](https://x.com/hilalisevenbiri)  
> **Metrics:** 18 likes · 1 retweets · 0 comments · 375 views  

> **Posted:** 2026-09-29T19:36:37+00:00  


> **Source Link:** [https://x.com/hilalisevenbiri/status/2105018930754470034](https://x.com/hilalisevenbiri/status/2105018930754470034)  


> 
> "Seni ısırırım bak bu ne"


### Discussion #97 by @cladzsol
> **Author:** [@cladzsol](https://x.com/cladzsol)  
> **Metrics:** 1 likes · 0 retweets · 0 comments · 374 views  

> **Posted:** 2026-09-29T17:40:16+00:00  


> **Source Link:** [https://x.com/cladzsol/status/2104989654025998441](https://x.com/cladzsol/status/2104989654025998441)  


> 
> "that is my goat"


### Discussion #98 by @Y2K_DOTCOM
> **Author:** [@Y2K_DOTCOM](https://x.com/Y2K_DOTCOM)  
> **Metrics:** 11 likes · 2 retweets · 0 comments · 370 views  

> **Posted:** 2026-09-29T19:45:41+00:00  


> **Source Link:** [https://x.com/Y2K_DOTCOM/status/2105021214343475379](https://x.com/Y2K_DOTCOM/status/2105021214343475379)  


> 
> "What’s your top 9"


### Discussion #99 by @GuadalupeSmzv5
> **Author:** [@GuadalupeSmzv5](https://x.com/GuadalupeSmzv5)  
> **Metrics:** 9 likes · 9 retweets · 0 comments · 370 views  

> **Posted:** 2026-09-29T18:22:04+00:00  


> **Source Link:** [https://x.com/GuadalupeSmzv5/status/2105000169511272933](https://x.com/GuadalupeSmzv5/status/2105000169511272933)  


> 
> "broadcastw.twiig.ink/GlTQvXkyJ.mp4
broadcastw.twiig.ink/FbwIDdUZf.mp4"


### Discussion #100 by @swiftinspires
> **Author:** [@swiftinspires](https://x.com/swiftinspires)  
> **Metrics:** 20 likes · 4 retweets · 0 comments · 368 views  

> **Posted:** 2026-09-29T19:25:07+00:00  


> **Source Link:** [https://x.com/swiftinspires/status/2105016038761062477](https://x.com/swiftinspires/status/2105016038761062477)  


> 
> "no fucking way"


### Discussion #101 by @dona_pily2
> **Author:** [@dona_pily2](https://x.com/dona_pily2)  
> **Metrics:** 4 likes · 1 retweets · 1 comments · 366 views  

> **Posted:** 2026-09-29T18:40:20+00:00  


> **Source Link:** [https://x.com/dona_pily2/status/2105004768900845867](https://x.com/dona_pily2/status/2105004768900845867)  


> 
> "Se busca a  Pato."


### Discussion #102 by @MarionYurotjdx
> **Author:** [@MarionYurotjdx](https://x.com/MarionYurotjdx)  
> **Metrics:** 4 likes · 10 retweets · 0 comments · 363 views  

> **Posted:** 2026-09-29T17:59:57+00:00  


> **Source Link:** [https://x.com/MarionYurotjdx/status/2104994605934747903](https://x.com/MarionYurotjdx/status/2104994605934747903)  


> 
> "footagew.twitf.ink/WtOziJSSL.mp4
footagew.twitf.ink/DPYjQGHmD.mp4"


### Discussion #103 by @prolifefrenchie
> **Author:** [@prolifefrenchie](https://x.com/prolifefrenchie)  
> **Metrics:** 1 likes · 0 retweets · 0 comments · 357 views  

> **Posted:** 2026-09-29T19:23:04+00:00  


> **Source Link:** [https://x.com/prolifefrenchie/status/2105015521687060883](https://x.com/prolifefrenchie/status/2105015521687060883)  


> 
> "But I very much deserve one"


### Discussion #104 by @yuuuukiiii_168
> **Author:** [@yuuuukiiii_168](https://x.com/yuuuukiiii_168)  
> **Metrics:** 13 likes · 0 retweets · 2 comments · 350 views  

> **Posted:** 2026-09-29T19:00:35+00:00  


> **Source Link:** [https://x.com/yuuuukiiii_168/status/2105009864858816793](https://x.com/yuuuukiiii_168/status/2105009864858816793)  


> 
> "Life is just chewing without meaning"


### Discussion #105 by @swd2
> **Author:** [@swd2](https://x.com/swd2)  
> **Metrics:** 1 likes · 0 retweets · 0 comments · 350 views  

> **Posted:** 2026-09-29T18:56:43+00:00  


> **Source Link:** [https://x.com/swd2/status/2105008893122257400](https://x.com/swd2/status/2105008893122257400)  


> 
> "OMG it's happening!!"


### Discussion #106 by @AgriPulseWorld
> **Author:** [@AgriPulseWorld](https://x.com/AgriPulseWorld)  
> **Metrics:** 1 likes · 1 retweets · 0 comments · 349 views  

> **Posted:** 2026-09-29T19:30:07+00:00  


> **Source Link:** [https://x.com/AgriPulseWorld/status/2105017296687165625](https://x.com/AgriPulseWorld/status/2105017296687165625)  


> 
> "Most daily useful tips needed for you"


### Discussion #107 by @yuri_yurikadesu
> **Author:** [@yuri_yurikadesu](https://x.com/yuri_yurikadesu)  
> **Metrics:** 9 likes · 0 retweets · 0 comments · 347 views  

> **Posted:** 2026-09-29T17:59:25+00:00  


> **Source Link:** [https://x.com/yuri_yurikadesu/status/2104994470865616971](https://x.com/yuri_yurikadesu/status/2104994470865616971)  


> 
> "Aujuaとリファどっちのシャンプーが良いのだろうか"


### Discussion #108 by @sasswithay
> **Author:** [@sasswithay](https://x.com/sasswithay)  
> **Metrics:** 2 likes · 0 retweets · 0 comments · 346 views  

> **Posted:** 2026-09-29T19:37:59+00:00  


> **Source Link:** [https://x.com/sasswithay/status/2105019275182473393](https://x.com/sasswithay/status/2105019275182473393)  


> 
> "Huh?"


### Discussion #109 by @LabMariam48488
> **Author:** [@LabMariam48488](https://x.com/LabMariam48488)  
> **Metrics:** 1 likes · 0 retweets · 0 comments · 343 views  

> **Posted:** 2026-09-29T18:32:37+00:00  


> **Source Link:** [https://x.com/LabMariam48488/status/2105002824711262678](https://x.com/LabMariam48488/status/2105002824711262678)  


> 
> "Steak With Creay Spicy Mushroom Sauce"


### Discussion #110 by @yualunaofficial
> **Author:** [@yualunaofficial](https://x.com/yualunaofficial)  
> **Metrics:** 13 likes · 0 retweets · 1 comments · 332 views  

> **Posted:** 2026-09-29T18:05:57+00:00  


> **Source Link:** [https://x.com/yualunaofficial/status/2104996114470699024](https://x.com/yualunaofficial/status/2104996114470699024)  


> **Visual Context:** A hand holding a clear plastic cup containing a pink, blended beverage with a straw, set against a plain beige wall.  

> 
> "Protein Hwachae Recipe

I just tried this at work and it’s FIRE

Ingredients
- 1 Cup Watermelon
- 1 Mini Grapefruit Fresca (Usually you use Korean Sprite but I used this since it’s still sweet but 0 calories)
- 1 Strawberry Milkshake Nurri (Fill the rest of cup)"


### Discussion #111 by @ryuk3nn
> **Author:** [@ryuk3nn](https://x.com/ryuk3nn)  
> **Metrics:** 13 likes · 0 retweets · 5 comments · 332 views  

> **Posted:** 2026-09-29T19:01:40+00:00  


> **Source Link:** [https://x.com/ryuk3nn/status/2105010135127015591](https://x.com/ryuk3nn/status/2105010135127015591)  


> **Visual Context:** A young deer standing in a grassy field with a backdrop of dense green trees and foliage.  

> 
> "What the hell are you looking at chump"


### Discussion #112 by @Veyrix222
> **Author:** [@Veyrix222](https://x.com/Veyrix222)  
> **Metrics:** 13 likes · 2 retweets · 1 comments · 330 views  

> **Posted:** 2026-09-29T19:15:22+00:00  


> **Source Link:** [https://x.com/Veyrix222/status/2105013584828985666](https://x.com/Veyrix222/status/2105013584828985666)  


> **Visual Context:** A phone lock screen showing 'Wed Sep 30, 03:11' on a 中国电信 (China Telecom) network, featuring two men in black and gold NRG esports jerseys.  

> 
> "Got a new wallpaper"


### Discussion #113 by @bearlyable2
> **Author:** [@bearlyable2](https://x.com/bearlyable2)  
> **Metrics:** 5 likes · 1 retweets · 1 comments · 325 views  

> **Posted:** 2026-09-29T19:04:59+00:00  


> **Source Link:** [https://x.com/bearlyable2/status/2105010970590609745](https://x.com/bearlyable2/status/2105010970590609745)  


> 
> "Death wish….."


### Discussion #114 by @SpoilHan
> **Author:** [@SpoilHan](https://x.com/SpoilHan)  
> **Metrics:** 6 likes · 0 retweets · 0 comments · 321 views  

> **Posted:** 2026-09-29T18:58:58+00:00  


> **Source Link:** [https://x.com/SpoilHan/status/2105009456685916357](https://x.com/SpoilHan/status/2105009456685916357)  


> 
> "active to take what's mine <3."


### Discussion #115 by @TradesTalk
> **Author:** [@TradesTalk](https://x.com/TradesTalk)  
> **Metrics:** 5 likes · 1 retweets · 6 comments · 321 views  

> **Posted:** 2026-09-29T19:05:48+00:00  


> **Source Link:** [https://x.com/TradesTalk/status/2105011178275561934](https://x.com/TradesTalk/status/2105011178275561934)  


> **Visual Context:** A worker in a high-visibility yellow vest labeled “AkariTech” stands on a red industrial platform beside large machinery inside a warehouse.  

> 
> "We are currently fitting out a warehouse with frost protection... So I am currently hyper-aware of my chances of falling to my death #TradesTalk

A1: What’s the biggest health & safety risk you regularly face in your trade, and do you think people take it seriously enough?"


### Discussion #116 by @sirDukeDevin
> **Author:** [@sirDukeDevin](https://x.com/sirDukeDevin)  
> **Metrics:** 52 likes · 35 retweets · 2 comments · 318 views  

> **Posted:** 2026-09-29T19:35:28+00:00  


> **Source Link:** [https://x.com/sirDukeDevin/status/2105018644631597475](https://x.com/sirDukeDevin/status/2105018644631597475)  


> **Visual Context:** A social media post attributed to 'ileana.justine' features text criticizing powerful men and includes photos of Brett Kavanaugh, Pete Hegseth, RFK Jr., and Donald Trump.  

> 
> "Spot on"


### Discussion #117 by @tabbyOSRS
> **Author:** [@tabbyOSRS](https://x.com/tabbyOSRS)  
> **Metrics:** 10 likes · 0 retweets · 1 comments · 313 views  

> **Posted:** 2026-09-29T18:49:17+00:00  


> **Source Link:** [https://x.com/tabbyOSRS/status/2105007022186066054](https://x.com/tabbyOSRS/status/2105007022186066054)  


> 
> "do they have beer and cigarettes at the paddington experience"


### Discussion #118 by @ExoticElena1
> **Author:** [@ExoticElena1](https://x.com/ExoticElena1)  
> **Metrics:** 5 likes · 0 retweets · 1 comments · 313 views  

> **Posted:** 2026-09-29T18:37:19+00:00  


> **Source Link:** [https://x.com/ExoticElena1/status/2105004008003748223](https://x.com/ExoticElena1/status/2105004008003748223)  


> 
> "Go fetch dessert x3"


### Discussion #119 by @nxkpq41516724
> **Author:** [@nxkpq41516724](https://x.com/nxkpq41516724)  
> **Metrics:** 10 likes · 2 retweets · 5 comments · 312 views  

> **Posted:** 2026-09-29T18:43:36+00:00  


> **Source Link:** [https://x.com/nxkpq41516724/status/2105005591127351633](https://x.com/nxkpq41516724/status/2105005591127351633)  


> **Visual Context:** A woman posing indoors wearing a blue lingerie set with matching thigh-high stockings.  

> 
> "Will you like to give me some massage?"


### Discussion #120 by @Sabiha1278
> **Author:** [@Sabiha1278](https://x.com/Sabiha1278)  
> **Metrics:** 23 likes · 16 retweets · 0 comments · 308 views  

> **Posted:** 2026-09-29T19:25:00+00:00  


> **Source Link:** [https://x.com/Sabiha1278/status/2105016007492526575](https://x.com/Sabiha1278/status/2105016007492526575)  


> 
> "THIS RESCUED PUPPY NEEDS VET CARE 

This sweet puppy is finally safe with food, a warm place to sleep and lots of care.  But the next step is important — veterinary treatment.

The puppy needs vaccinations, deworming and a full health check so they can start life healthy"


### Discussion #121 by @HonestTakesX
> **Author:** [@HonestTakesX](https://x.com/HonestTakesX)  
> **Metrics:** 5 likes · 1 retweets · 3 comments · 308 views  

> **Posted:** 2026-09-29T19:35:08+00:00  


> **Source Link:** [https://x.com/HonestTakesX/status/2105018557746864308](https://x.com/HonestTakesX/status/2105018557746864308)  


> **Visual Context:** A purple textured eye test image asks 'What number do you see??' at the bottom.  

> 
> "Can you find the hidden number in this picture?"


### Discussion #122 by @persimmonnss
> **Author:** [@persimmonnss](https://x.com/persimmonnss)  
> **Metrics:** 18 likes · 1 retweets · 1 comments · 306 views  

> **Posted:** 2026-09-29T19:39:09+00:00  


> **Source Link:** [https://x.com/persimmonnss/status/2105019568653783391](https://x.com/persimmonnss/status/2105019568653783391)  


> 
> "you could make a whole thread with these.."


### Discussion #123 by @JudyK8e2sox
> **Author:** [@JudyK8e2sox](https://x.com/JudyK8e2sox)  
> **Metrics:** 17 likes · 0 retweets · 1 comments · 306 views  

> **Posted:** 2026-09-29T18:47:53+00:00  


> **Source Link:** [https://x.com/JudyK8e2sox/status/2105006666974462058](https://x.com/JudyK8e2sox/status/2105006666974462058)  


> 
> "Attention Please
In light of da ballie’s recent mysterious deflation…I have renamed it
Meet Floppy. 
You may continue with your day#dogsoftwitter #dogsofx #englishfoxredlabpuppy"


### Discussion #124 by @sam_ee__
> **Author:** [@sam_ee__](https://x.com/sam_ee__)  
> **Metrics:** 8 likes · 0 retweets · 5 comments · 304 views  

> **Posted:** 2026-09-29T18:22:41+00:00  


> **Source Link:** [https://x.com/sam_ee__/status/2105000325107404849](https://x.com/sam_ee__/status/2105000325107404849)  


> 
> "turn your phone sideways!"


### Discussion #125 by @rainingtanaa
> **Author:** [@rainingtanaa](https://x.com/rainingtanaa)  
> **Metrics:** 19 likes · 1 retweets · 1 comments · 303 views  

> **Posted:** 2026-09-29T19:17:49+00:00  


> **Source Link:** [https://x.com/rainingtanaa/status/2105014202725195816](https://x.com/rainingtanaa/status/2105014202725195816)  


> 
> "like what u see?"


### Discussion #126 by @sig_gma
> **Author:** [@sig_gma](https://x.com/sig_gma)  
> **Metrics:** 30 likes · 0 retweets · 14 comments · 296 views  

> **Posted:** 2026-09-29T18:20:30+00:00  


> **Source Link:** [https://x.com/sig_gma/status/2104999777218027658](https://x.com/sig_gma/status/2104999777218027658)  


> 
> "GN Fams 
Let's call it a day."


### Discussion #127 by @fabiolarroyof
> **Author:** [@fabiolarroyof](https://x.com/fabiolarroyof)  
> **Metrics:** 2 likes · 0 retweets · 0 comments · 296 views  

> **Posted:** 2026-09-29T19:03:46+00:00  


> **Source Link:** [https://x.com/fabiolarroyof/status/2105010667174396037](https://x.com/fabiolarroyof/status/2105010667174396037)  


> 
> "Would this be considered my first viral tweeeeet?"


### Discussion #128 by @JLeBus
> **Author:** [@JLeBus](https://x.com/JLeBus)  
> **Metrics:** 2 likes · 1 retweets · 0 comments · 294 views  

> **Posted:** 2026-09-29T18:00:52+00:00  


> **Source Link:** [https://x.com/JLeBus/status/2104994835992346652](https://x.com/JLeBus/status/2104994835992346652)  


> 
> "Prepare Accordingly...."


### Discussion #129 by @yunjingoiana
> **Author:** [@yunjingoiana](https://x.com/yunjingoiana)  
> **Metrics:** 9 likes · 0 retweets · 2 comments · 289 views  

> **Posted:** 2026-09-29T17:49:53+00:00  


> **Source Link:** [https://x.com/yunjingoiana/status/2104992072742662603](https://x.com/yunjingoiana/status/2104992072742662603)  


> **Visual Context:** A young blonde woman with long hair poses in a dark purple bikini at a nighttime pool setting.  

> 
> "WJRKSKKSHWKSCSLCWLWFWCWLWFWMWGWNWCKWFWKWVWKWVWKWVJW"


### Discussion #130 by @xclusivestories
> **Author:** [@xclusivestories](https://x.com/xclusivestories)  
> **Metrics:** 2 likes · 2 retweets · 0 comments · 289 views  

> **Posted:** 2026-09-29T18:48:44+00:00  


> **Source Link:** [https://x.com/xclusivestories/status/2105006882482262234](https://x.com/xclusivestories/status/2105006882482262234)  


> **Visual Context:** A Netflix promotional image for 'Tyler Perry's Conspiracy' new film featuring side-by-side portraits of actors Lucien Laviscount and Taylor Paige.  

> 
> "here we go…."


### Discussion #131 by @Cathleen60Scott
> **Author:** [@Cathleen60Scott](https://x.com/Cathleen60Scott)  
> **Metrics:** 16 likes · 3 retweets · 2 comments · 287 views  

> **Posted:** 2026-09-29T18:15:55+00:00  


> **Source Link:** [https://x.com/Cathleen60Scott/status/2104998623998284142](https://x.com/Cathleen60Scott/status/2104998623998284142)  


> 
> "yes"


### Discussion #132 by @daquandgo
> **Author:** [@daquandgo](https://x.com/daquandgo)  
> **Metrics:** 10 likes · 0 retweets · 0 comments · 286 views  

> **Posted:** 2026-09-29T18:07:49+00:00  


> **Source Link:** [https://x.com/daquandgo/status/2104996583276421287](https://x.com/daquandgo/status/2104996583276421287)  


> 
> "Menu  
t.me/Daquand01

Alabama weed, Alaska weed, Arizona weed, Arkansas weed, California weed, Colorado weed, Connecticut weed, Delaware weed, Florida weed, Georgia weed, Hawaii weed, Idaho weed, Illinois weed, Indiana weed, Iowa weed"


### Discussion #133 by @adamho
> **Author:** [@adamho](https://x.com/adamho)  
> **Metrics:** 4 likes · 0 retweets · 0 comments · 284 views  

> **Posted:** 2026-09-29T18:39:58+00:00  


> **Source Link:** [https://x.com/adamho/status/2105004674617413782](https://x.com/adamho/status/2105004674617413782)  


> 
> "fots"


### Discussion #134 by @futchjuun
> **Author:** [@futchjuun](https://x.com/futchjuun)  
> **Metrics:** 16 likes · 0 retweets · 1 comments · 280 views  

> **Posted:** 2026-09-29T18:44:18+00:00  


> **Source Link:** [https://x.com/futchjuun/status/2105005768525410425](https://x.com/futchjuun/status/2105005768525410425)  


> 
> ""lemon tang is shit""


### Discussion #135 by @CS_WiNagisa
> **Author:** [@CS_WiNagisa](https://x.com/CS_WiNagisa)  
> **Metrics:** 5 likes · 0 retweets · 0 comments · 280 views  

> **Posted:** 2026-09-29T17:54:22+00:00  


> **Source Link:** [https://x.com/CS_WiNagisa/status/2104993199735591413](https://x.com/CS_WiNagisa/status/2104993199735591413)  


> 
> "可愛すぎる"


### Discussion #136 by @1aridanielle
> **Author:** [@1aridanielle](https://x.com/1aridanielle)  
> **Metrics:** 0 likes · 0 retweets · 0 comments · 276 views  

> **Posted:** 2026-09-29T19:01:02+00:00  


> **Source Link:** [https://x.com/1aridanielle/status/2105009978260205636](https://x.com/1aridanielle/status/2105009978260205636)  


> **Visual Context:** A close-up of a digital pregnancy test with the words 'pregnant' and 'not pregnant' visible, showing a glowing yellow engine check light symbol in the result window instead of a typical indicator.  

> 
> "give that pussy a rest it’s been through enough."


### Discussion #137 by @dachshundlove06
> **Author:** [@dachshundlove06](https://x.com/dachshundlove06)  
> **Metrics:** 9 likes · 0 retweets · 0 comments · 274 views  

> **Posted:** 2026-09-29T18:19:45+00:00  


> **Source Link:** [https://x.com/dachshundlove06/status/2104999590345036123](https://x.com/dachshundlove06/status/2104999590345036123)  


> 
> "𝗔𝗡𝗬𝗢𝗡𝗘 𝗡𝗘𝗘𝗗 𝗧𝗛𝗜𝗦 𝗝𝗨𝗦𝗧 𝗪𝗥𝗜𝗧𝗘  "𝗜 𝗪𝗔𝗡𝗧"                           Get yours now : 
doggiftworld.com/products/dachs
…"


### Discussion #138 by @eShlonAnsak
> **Author:** [@eShlonAnsak](https://x.com/eShlonAnsak)  
> **Metrics:** 9 likes · 0 retweets · 0 comments · 274 views  

> **Posted:** 2026-09-29T17:55:41+00:00  


> **Source Link:** [https://x.com/eShlonAnsak/status/2104993530133250152](https://x.com/eShlonAnsak/status/2104993530133250152)  


> 
> "who want me"


### Discussion #139 by @AlexandraCueva
> **Author:** [@AlexandraCueva](https://x.com/AlexandraCueva)  
> **Metrics:** 13 likes · 1 retweets · 2 comments · 270 views  

> **Posted:** 2026-09-29T18:27:38+00:00  


> **Source Link:** [https://x.com/AlexandraCueva/status/2105001570639516000](https://x.com/AlexandraCueva/status/2105001570639516000)  


> 
> "Se me antojó un pancito con mermelada de fresa"


### Discussion #140 by @AinoKana
> **Author:** [@AinoKana](https://x.com/AinoKana)  
> **Metrics:** 2 likes · 1 retweets · 1 comments · 268 views  

> **Posted:** 2026-09-29T18:50:26+00:00  


> **Source Link:** [https://x.com/AinoKana/status/2105007310515188204](https://x.com/AinoKana/status/2105007310515188204)  


> 
> "シリコンバンド落としたの誰ー！！
アイリゾで受け取った人の誰か！"


### Discussion #141 by @KittyCatEmpire
> **Author:** [@KittyCatEmpire](https://x.com/KittyCatEmpire)  
> **Metrics:** 10 likes · 1 retweets · 0 comments · 267 views  

> **Posted:** 2026-09-29T19:42:08+00:00  


> **Source Link:** [https://x.com/KittyCatEmpire/status/2105020320742596720](https://x.com/KittyCatEmpire/status/2105020320742596720)  


> 
> "never give up!"


### Discussion #142 by @d_only_pawaz
> **Author:** [@d_only_pawaz](https://x.com/d_only_pawaz)  
> **Metrics:** 4 likes · 5 retweets · 0 comments · 263 views  

> **Posted:** 2026-09-29T19:28:39+00:00  


> **Source Link:** [https://x.com/d_only_pawaz/status/2105016928515367205](https://x.com/d_only_pawaz/status/2105016928515367205)  


> 
> "New and unique onion chopping technique"


### Discussion #143 by @ivelvetzy
> **Author:** [@ivelvetzy](https://x.com/ivelvetzy)  
> **Metrics:** 6 likes · 1 retweets · 0 comments · 251 views  

> **Posted:** 2026-09-29T18:35:27+00:00  


> **Source Link:** [https://x.com/ivelvetzy/status/2105003538099360133](https://x.com/ivelvetzy/status/2105003538099360133)  


> 
> "discovery of the day"


### Discussion #144 by @jnkmnbal
> **Author:** [@jnkmnbal](https://x.com/jnkmnbal)  
> **Metrics:** 3 likes · 1 retweets · 0 comments · 248 views  

> **Posted:** 2026-09-29T17:50:33+00:00  


> **Source Link:** [https://x.com/jnkmnbal/status/2104992237989900643](https://x.com/jnkmnbal/status/2104992237989900643)  


> **Visual Context:** An Instagram post from verified user 'aerichandesu' with 100K likes shows two women standing on a beach at dusk with their backs to the camera, listening to 'Popcaan - Fall In Love'.  

> 
> "elas são muito meu #goals"


### Discussion #145 by @gaebii_
> **Author:** [@gaebii_](https://x.com/gaebii_)  
> **Metrics:** 3 likes · 1 retweets · 0 comments · 248 views  

> **Posted:** 2026-09-29T19:18:51+00:00  


> **Source Link:** [https://x.com/gaebii_/status/2105014461681873152](https://x.com/gaebii_/status/2105014461681873152)  


> 
> "꼭 새벽에 배고픔ㅆㅂㅠㅠ"


### Discussion #146 by @glossydesiree
> **Author:** [@glossydesiree](https://x.com/glossydesiree)  
> **Metrics:** 13 likes · 2 retweets · 0 comments · 242 views  

> **Posted:** 2026-09-29T19:42:12+00:00  


> **Source Link:** [https://x.com/glossydesiree/status/2105020339482702295](https://x.com/glossydesiree/status/2105020339482702295)  


> 
> "you like my top?"


### Discussion #147 by @SpoilHan
> **Author:** [@SpoilHan](https://x.com/SpoilHan)  
> **Metrics:** 11 likes · 1 retweets · 1 comments · 242 views  

> **Posted:** 2026-09-29T19:35:17+00:00  


> **Source Link:** [https://x.com/SpoilHan/status/2105018596644606185](https://x.com/SpoilHan/status/2105018596644606185)  


> **Visual Context:** A blonde woman wearing sunglasses on her head, a black sports bra, and a partially unzipped black jacket, taking a selfie in a bedroom with a pink gaming chair visible in the background.  

> 
> "hiiii new followers"


### Discussion #148 by @thecyberbaddie
> **Author:** [@thecyberbaddie](https://x.com/thecyberbaddie)  
> **Metrics:** 10 likes · 0 retweets · 3 comments · 238 views  

> **Posted:** 2026-09-29T18:56:05+00:00  


> **Source Link:** [https://x.com/thecyberbaddie/status/2105008732858204258](https://x.com/thecyberbaddie/status/2105008732858204258)  


> 
> "Hiii"


### Discussion #149 by @0xadi5
> **Author:** [@0xadi5](https://x.com/0xadi5)  
> **Metrics:** 7 likes · 0 retweets · 1 comments · 234 views  

> **Posted:** 2026-09-29T18:41:49+00:00  


> **Source Link:** [https://x.com/0xadi5/status/2105005139803455985](https://x.com/0xadi5/status/2105005139803455985)  


> **Visual Context:** A screenshot of a dark-mode text message conversation where someone writes 'That's fucking hilarious lol' followed by 'I got a couple positions on fomo rn I may transfer to definitive before I sell.'  

> 
> "My friend is evolving"


### Discussion #150 by @itsmyliffe2004
> **Author:** [@itsmyliffe2004](https://x.com/itsmyliffe2004)  
> **Metrics:** 2 likes · 0 retweets · 1 comments · 233 views  

> **Posted:** 2026-09-29T19:35:35+00:00  


> **Source Link:** [https://x.com/itsmyliffe2004/status/2105018673052488107](https://x.com/itsmyliffe2004/status/2105018673052488107)  


> 
> "Sun looks so perfect"


### Discussion #151 by @cp_koebi
> **Author:** [@cp_koebi](https://x.com/cp_koebi)  
> **Metrics:** 6 likes · 0 retweets · 0 comments · 231 views  

> **Posted:** 2026-09-29T17:50:30+00:00  


> **Source Link:** [https://x.com/cp_koebi/status/2104992227357573469](https://x.com/cp_koebi/status/2104992227357573469)  


> 
> "あした16じからいます！きてね！10月は16じだったりごじだったり前半はそうです！"


### Discussion #152 by @d_only_pawaz
> **Author:** [@d_only_pawaz](https://x.com/d_only_pawaz)  
> **Metrics:** 4 likes · 4 retweets · 0 comments · 231 views  

> **Posted:** 2026-09-29T19:26:59+00:00  


> **Source Link:** [https://x.com/d_only_pawaz/status/2105016506904166549](https://x.com/d_only_pawaz/status/2105016506904166549)  


> 
> "Newest chicken recipe on the block"


### Discussion #153 by @bigliss28
> **Author:** [@bigliss28](https://x.com/bigliss28)  
> **Metrics:** 4 likes · 0 retweets · 1 comments · 231 views  

> **Posted:** 2026-09-29T18:46:52+00:00  


> **Source Link:** [https://x.com/bigliss28/status/2105006413731037431](https://x.com/bigliss28/status/2105006413731037431)  


> 
> "That basic thing done really well and at the same time luxurious, I liked it."


### Discussion #154 by @Dtdoong9
> **Author:** [@Dtdoong9](https://x.com/Dtdoong9)  
> **Metrics:** 8 likes · 1 retweets · 1 comments · 218 views  

> **Posted:** 2026-09-29T18:21:44+00:00  


> **Source Link:** [https://x.com/Dtdoong9/status/2105000088946807087](https://x.com/Dtdoong9/status/2105000088946807087)  


> 
> "A veces me dan mucha pena xd"


### Discussion #155 by @Laurillax10
> **Author:** [@Laurillax10](https://x.com/Laurillax10)  
> **Metrics:** 8 likes · 2 retweets · 4 comments · 212 views  

> **Posted:** 2026-09-29T18:55:34+00:00  


> **Source Link:** [https://x.com/Laurillax10/status/2105008603375571104](https://x.com/Laurillax10/status/2105008603375571104)  


> **Visual Context:** A close-up of a cockatiel bird with a yellow crest, orange cheek patches, and grey and white patterned wings sits in front of a window.  

> 
> "Se ha ido mi Canijita.... Era el pajarito más bueno y cariñoso del mundo, te voy a echar de menos cada día... He intentado cuidarte lo mejor posible, espero que hayas sido feliz, vuela alto mi pequeña...te quiero #Cani #Canijita #tequiero"


### Discussion #156 by @Pampa139
> **Author:** [@Pampa139](https://x.com/Pampa139)  
> **Metrics:** 9 likes · 6 retweets · 1 comments · 211 views  

> **Posted:** 2026-09-29T19:46:05+00:00  


> **Source Link:** [https://x.com/Pampa139/status/2105021315069665734](https://x.com/Pampa139/status/2105021315069665734)  


> 
> "Este fue el que se murió?"


### Discussion #157 by @Nene__oli
> **Author:** [@Nene__oli](https://x.com/Nene__oli)  
> **Metrics:** 12 likes · 1 retweets · 0 comments · 210 views  

> **Posted:** 2026-09-29T18:21:42+00:00  


> **Source Link:** [https://x.com/Nene__oli/status/2105000080822403542](https://x.com/Nene__oli/status/2105000080822403542)  


> 
> "If you have nothing nice to say... kindly zip your yapper

Aka shut the fuck up"


### Discussion #158 by @_cosmicearth
> **Author:** [@_cosmicearth](https://x.com/_cosmicearth)  
> **Metrics:** 1 likes · 0 retweets · 0 comments · 210 views  

> **Posted:** 2026-09-29T19:23:17+00:00  


> **Source Link:** [https://x.com/_cosmicearth/status/2105015578062684615](https://x.com/_cosmicearth/status/2105015578062684615)  


> 
> "What would you do in this situation?"


### Discussion #159 by @KjaosTFT
> **Author:** [@KjaosTFT](https://x.com/KjaosTFT)  
> **Metrics:** 2 likes · 0 retweets · 0 comments · 205 views  

> **Posted:** 2026-09-29T18:45:56+00:00  


> **Source Link:** [https://x.com/KjaosTFT/status/2105006177885335992](https://x.com/KjaosTFT/status/2105006177885335992)  


> **Visual Context:** A promotional image showing a Riftbound TCG playmat featuring the character Ekko, with text overlay reading 'New Seraphine and Ekko playmats.'  

> 
> "ME ME ME PLSSS"


### Discussion #160 by @SecondLookDesk
> **Author:** [@SecondLookDesk](https://x.com/SecondLookDesk)  
> **Metrics:** 2 likes · 0 retweets · 1 comments · 201 views  

> **Posted:** 2026-09-29T19:37:01+00:00  


> **Source Link:** [https://x.com/SecondLookDesk/status/2105019034018181264](https://x.com/SecondLookDesk/status/2105019034018181264)  


> 
> "That was far too close. A split second to react, and just enough room to escape."


### Discussion #161 by @reddit
> **Author:** [@reddit](https://x.com/reddit)  
> **Metrics:** 2 likes · 0 retweets · 5 comments · 200 views  

> **Posted:** 2026-09-29T19:01:44.181000+00:00  



> 
> "quick question"


### Discussion #162 by @filmenchante
> **Author:** [@filmenchante](https://x.com/filmenchante)  
> **Metrics:** 4 likes · 0 retweets · 0 comments · 193 views  

> **Posted:** 2026-09-29T19:05:19+00:00  


> **Source Link:** [https://x.com/filmenchante/status/2105011054866796899](https://x.com/filmenchante/status/2105011054866796899)  


> **Visual Context:** A retail display in a store (likely Tesco, given the Clubcard branding) advertises a limited edition Johnnie Walker Sabrina Carpenter Blended Scotch Whisky, priced at £36.25 with a Clubcard Price of £24, featuring the singer's portrait.  

> 
> "omg. i want it so bad"


### Discussion #163 by @natashalynnm74
> **Author:** [@natashalynnm74](https://x.com/natashalynnm74)  
> **Metrics:** 10 likes · 0 retweets · 1 comments · 189 views  

> **Posted:** 2026-09-29T18:46:33+00:00  


> **Source Link:** [https://x.com/natashalynnm74/status/2105006333749874721](https://x.com/natashalynnm74/status/2105006333749874721)  


> **Visual Context:** A scenic landscape photo of a sunlit lake and mountain framed by pine trees, with sun rays streaming through clouds.  

> 
> "Crater lake, Oregon"


### Discussion #164 by @feifan7686
> **Author:** [@feifan7686](https://x.com/feifan7686)  
> **Metrics:** 1 likes · 0 retweets · 1 comments · 187 views  

> **Posted:** 2026-09-29T19:00:52+00:00  


> **Source Link:** [https://x.com/feifan7686/status/2105009937525158063](https://x.com/feifan7686/status/2105009937525158063)  


> 
> "房间里最聪明的人通常为房间里最勇敢的人工作。"


### Discussion #165 by @Goddess5Evaa
> **Author:** [@Goddess5Evaa](https://x.com/Goddess5Evaa)  
> **Metrics:** 2 likes · 0 retweets · 0 comments · 186 views  

> **Posted:** 2026-09-29T18:54:00+00:00  


> **Source Link:** [https://x.com/Goddess5Evaa/status/2105008207026352471](https://x.com/Goddess5Evaa/status/2105008207026352471)  


> 
> "Pick one: 

no spending for yourself this week 

or 

I choose every unnecessary purchase you make"


### Discussion #166 by @mistressanime23
> **Author:** [@mistressanime23](https://x.com/mistressanime23)  
> **Metrics:** 2 likes · 1 retweets · 0 comments · 182 views  

> **Posted:** 2026-09-29T19:10:12+00:00  


> **Source Link:** [https://x.com/mistressanime23/status/2105012285307596855](https://x.com/mistressanime23/status/2105012285307596855)  


> 
> "New wallpaper."


### Discussion #167 by @ActuallyCaseyy
> **Author:** [@ActuallyCaseyy](https://x.com/ActuallyCaseyy)  
> **Metrics:** 5 likes · 0 retweets · 0 comments · 177 views  

> **Posted:** 2026-09-29T18:34:28+00:00  


> **Source Link:** [https://x.com/ActuallyCaseyy/status/2105003291319083262](https://x.com/ActuallyCaseyy/status/2105003291319083262)  


> **Visual Context:** A wide-eyed tabby cat wearing a purple and white cape or robe sits upright on a bed in front of a TV and framed pictures.  

> 
> "happy birthday to my sweet muffin girl. today would’ve been your 15th birthday! i miss you more than words can describe. these past 13 months without you have been so, so hard. i hope you’re enjoying all the golden hours and outside time, wherever you are now."


### Discussion #168 by @fallindimples
> **Author:** [@fallindimples](https://x.com/fallindimples)  
> **Metrics:** 1 likes · 0 retweets · 0 comments · 171 views  

> **Posted:** 2026-09-29T18:34:45+00:00  


> **Source Link:** [https://x.com/fallindimples/status/2105003362559398042](https://x.com/fallindimples/status/2105003362559398042)  


> 
> "แอบยิ้มครับ"


### Discussion #169 by @luvtooharddd
> **Author:** [@luvtooharddd](https://x.com/luvtooharddd)  
> **Metrics:** 15 likes · 2 retweets · 0 comments · 169 views  

> **Posted:** 2026-09-29T19:32:12+00:00  


> **Source Link:** [https://x.com/luvtooharddd/status/2105017819880419515](https://x.com/luvtooharddd/status/2105017819880419515)  


> 
> "♡"


### Discussion #170 by @Zoya01th
> **Author:** [@Zoya01th](https://x.com/Zoya01th)  
> **Metrics:** 10 likes · 1 retweets · 3 comments · 168 views  

> **Posted:** 2026-09-29T19:06:12+00:00  


> **Source Link:** [https://x.com/Zoya01th/status/2105011277135303071](https://x.com/Zoya01th/status/2105011277135303071)  


> 
> "Shopping mood: ON  What’s the first thing you’d buy if you were here?"


### Discussion #171 by @mistressanime23
> **Author:** [@mistressanime23](https://x.com/mistressanime23)  
> **Metrics:** 2 likes · 1 retweets · 0 comments · 167 views  

> **Posted:** 2026-09-29T19:06:10+00:00  


> **Source Link:** [https://x.com/mistressanime23/status/2105011270374031476](https://x.com/mistressanime23/status/2105011270374031476)  


> 
> "New wallpaper."


### Discussion #172 by @CNTraveler
> **Author:** [@CNTraveler](https://x.com/CNTraveler)  
> **Metrics:** 0 likes · 0 retweets · 0 comments · 167 views  

> **Posted:** 2026-09-29T19:53:51+00:00  


> **Source Link:** [https://x.com/CNTraveler/status/2105023267333685409](https://x.com/CNTraveler/status/2105023267333685409)  


> 
> "When they say "all aboard," they mean it."


### Discussion #173 by @CarloTheace
> **Author:** [@CarloTheace](https://x.com/CarloTheace)  
> **Metrics:** 5 likes · 0 retweets · 0 comments · 164 views  

> **Posted:** 2026-09-29T18:21:45+00:00  


> **Source Link:** [https://x.com/CarloTheace/status/2105000091136274555](https://x.com/CarloTheace/status/2105000091136274555)  


> **Visual Context:** A man wearing sunglasses sits in the driver's seat of a car with his seatbelt fastened, wearing a black "BATMAN" t-shirt with a graphic of the superhero. The "Outta here!!!" post suggests he's heading out on a drive, ready to leave.  

> 
> "Outta here!!!"


### Discussion #174 by @voidbitch2
> **Author:** [@voidbitch2](https://x.com/voidbitch2)  
> **Metrics:** 4 likes · 0 retweets · 3 comments · 161 views  

> **Posted:** 2026-09-29T18:06:18+00:00  


> **Source Link:** [https://x.com/voidbitch2/status/2104996201485468024](https://x.com/voidbitch2/status/2104996201485468024)  


> 
> "Stunning #feet #baretoes #naturalbeauty #footfetish"


### Discussion #175 by @iitmii29
> **Author:** [@iitmii29](https://x.com/iitmii29)  
> **Metrics:** 1 likes · 0 retweets · 0 comments · 156 views  

> **Posted:** 2026-09-29T15:13:42+00:00  


> **Source Link:** [https://x.com/iitmii29/status/2104952766313779557](https://x.com/iitmii29/status/2104952766313779557)  


> **Visual Context:** A Korean KakaoTalk chat shows user '까명잉' sending rapid text messages '야니ㅣ이ㅣㅣㅣ이ㅣ' and '뭐야ㅂㅂㅂㅂ야ㅂㅂㅂ' with timestamps of 00:13.  

> 
> "ㅋㅋㅋㅋㅋㅋㅋㅋㅋㅋㅋㅋㅋㅋㅋㅋㅋ귀여워ㅠㅡㅡ"


### Discussion #176 by @_dersp
> **Author:** [@_dersp](https://x.com/_dersp)  
> **Metrics:** 3 likes · 0 retweets · 0 comments · 154 views  

> **Posted:** 2026-09-29T16:47:03+00:00  


> **Source Link:** [https://x.com/_dersp/status/2104976259860377878](https://x.com/_dersp/status/2104976259860377878)  


> 
> "SP 125 Oswaldo Cruz
Trecho - Taubaté / Ubatuba:

Km 42 – Trevo de São Luís do Paraitinga

Tráfego normal nos dois sentidos
Tempo bom e boa visibilidade
Atenção: Trecho de serra sujeito à neblina"


### Discussion #177 by @Rgr58Rr
> **Author:** [@Rgr58Rr](https://x.com/Rgr58Rr)  
> **Metrics:** 10 likes · 0 retweets · 1 comments · 151 views  

> **Posted:** 2026-09-29T18:34:51+00:00  


> **Source Link:** [https://x.com/Rgr58Rr/status/2105003387104215400](https://x.com/Rgr58Rr/status/2105003387104215400)  


> 
> "And the thunder rolls."


### Discussion #178 by @1ajaay
> **Author:** [@1ajaay](https://x.com/1ajaay)  
> **Metrics:** 2 likes · 0 retweets · 0 comments · 147 views  

> **Posted:** 2026-09-29T19:00:03+00:00  


> **Source Link:** [https://x.com/1ajaay/status/2105009729135378722](https://x.com/1ajaay/status/2105009729135378722)  


> **Visual Context:** Multiple vertical digital ads for a "Rebel" pickleball paddle are displayed side-by-side, featuring headlines like "START YOUR ERA," "5 REASONS WHY THE ELITE SERIES IS THE PADDLE TO BEAT," and "YOUR FIRST AND FINAL PRO PADDLE."  

> 
> "Highlight lander for Rebel"


### Discussion #179 by @BabysaurioKim
> **Author:** [@BabysaurioKim](https://x.com/BabysaurioKim)  
> **Metrics:** 6 likes · 1 retweets · 1 comments · 146 views  

> **Posted:** 2026-09-29T18:28:10+00:00  


> **Source Link:** [https://x.com/BabysaurioKim/status/2105001706119430634](https://x.com/BabysaurioKim/status/2105001706119430634)  


> 
> "SILENCIO"


### Discussion #180 by @TRUSTAMUNDO
> **Author:** [@TRUSTAMUNDO](https://x.com/TRUSTAMUNDO)  
> **Metrics:** 10 likes · 2 retweets · 1 comments · 145 views  

> **Posted:** 2026-09-29T19:09:44+00:00  


> **Source Link:** [https://x.com/TRUSTAMUNDO/status/2105012166784917614](https://x.com/TRUSTAMUNDO/status/2105012166784917614)  


> 
> "Red is my favourite color"


### Discussion #181 by @IND__Sweety
> **Author:** [@IND__Sweety](https://x.com/IND__Sweety)  
> **Metrics:** 1 likes · 0 retweets · 0 comments · 143 views  

> **Posted:** 2026-09-29T19:14:29+00:00  


> **Source Link:** [https://x.com/IND__Sweety/status/2105013363336241456](https://x.com/IND__Sweety/status/2105013363336241456)  


> 
> "Turning Molds Into Something INSANE"


### Discussion #182 by @IND__Sweety
> **Author:** [@IND__Sweety](https://x.com/IND__Sweety)  
> **Metrics:** 1 likes · 0 retweets · 0 comments · 141 views  

> **Posted:** 2026-09-29T19:06:12+00:00  


> **Source Link:** [https://x.com/IND__Sweety/status/2105011275944309026](https://x.com/IND__Sweety/status/2105011275944309026)  


> 
> "This Spark Plug Hack Is GENIUS!"


### Discussion #183 by @rajuAhamed3800
> **Author:** [@rajuAhamed3800](https://x.com/rajuAhamed3800)  
> **Metrics:** 13 likes · 1 retweets · 10 comments · 135 views  

> **Posted:** 2026-09-29T18:47:13+00:00  


> **Source Link:** [https://x.com/rajuAhamed3800/status/2105006499097608508](https://x.com/rajuAhamed3800/status/2105006499097608508)  


> 
> "Good Night"


### Discussion #184 by @LaguitoGal
> **Author:** [@LaguitoGal](https://x.com/LaguitoGal)  
> **Metrics:** 9 likes · 2 retweets · 0 comments · 135 views  

> **Posted:** 2026-09-29T19:08:52+00:00  


> **Source Link:** [https://x.com/LaguitoGal/status/2105011948840513802](https://x.com/LaguitoGal/status/2105011948840513802)  


> 
> "Moon setting on the trail"


### Discussion #185 by @goldxrhino
> **Author:** [@goldxrhino](https://x.com/goldxrhino)  
> **Metrics:** 4 likes · 1 retweets · 3 comments · 135 views  

> **Posted:** 2026-09-29T17:54:36+00:00  


> **Source Link:** [https://x.com/goldxrhino/status/2104993257914822792](https://x.com/goldxrhino/status/2104993257914822792)  


> 
> "Renaiss日记 
Day104

简中30th皮卡丘收集计划
（亲开4/30）
收集的第4张是编号018的，是三十张皮卡丘里面的第二张。  

感谢朋友们分享的卡牌。挑选了一部份先收集入册了。其他的慢慢集换啦。
@0xKuromon
  老师一波支援直接帮我攒了大半卡组。

还有线下其他途径收集了，大都出现印刷线问题。"


### Discussion #186 by @NEKOdo_dai
> **Author:** [@NEKOdo_dai](https://x.com/NEKOdo_dai)  
> **Metrics:** 11 likes · 5 retweets · 0 comments · 132 views  

> **Posted:** 2026-09-29T19:20:38+00:00  


> **Source Link:** [https://x.com/NEKOdo_dai/status/2105014911697051790](https://x.com/NEKOdo_dai/status/2105014911697051790)  


> 
> "日にゃたぼこしたいにゃあ"


### Discussion #187 by @mosesnade6zv
> **Author:** [@mosesnade6zv](https://x.com/mosesnade6zv)  
> **Metrics:** 1 likes · 2 retweets · 3 comments · 131 views  

> **Posted:** 2026-09-29T18:22:36+00:00  


> **Source Link:** [https://x.com/mosesnade6zv/status/2105000307214455218](https://x.com/mosesnade6zv/status/2105000307214455218)  


> 
> "我每次爽的时候都会说些很涩的话...是不是太骚了... #每日大赛 #每日大赛 #每日大赛"


### Discussion #188 by @greedyrayy
> **Author:** [@greedyrayy](https://x.com/greedyrayy)  
> **Metrics:** 3 likes · 0 retweets · 0 comments · 126 views  

> **Posted:** 2026-09-29T19:28:53+00:00  


> **Source Link:** [https://x.com/greedyrayy/status/2105016987445518589](https://x.com/greedyrayy/status/2105016987445518589)  


> 
> "between all of my social platforms i have 22k followers"


### Discussion #189 by @Katealice518639
> **Author:** [@Katealice518639](https://x.com/Katealice518639)  
> **Metrics:** 5 likes · 0 retweets · 0 comments · 124 views  

> **Posted:** 2026-09-29T17:53:41+00:00  


> **Source Link:** [https://x.com/Katealice518639/status/2104993029014851933](https://x.com/Katealice518639/status/2104993029014851933)  


> **Visual Context:** A woman in a green lingerie set posing on the floor while taking a mirror selfie in a sunroom with large windows.  

> 
> "Any name for me"


### Discussion #190 by @spoilrenaa
> **Author:** [@spoilrenaa](https://x.com/spoilrenaa)  
> **Metrics:** 5 likes · 1 retweets · 0 comments · 123 views  

> **Posted:** 2026-09-29T18:46:17+00:00  


> **Source Link:** [https://x.com/spoilrenaa/status/2105006266561233280](https://x.com/spoilrenaa/status/2105006266561233280)  


> **Visual Context:** A screenshot showing an amount of $479.04 and a profile page for @puffles with the name '• princess •' alongside a profile photo and bunny-themed graphic.  

> 
> "Lets get this to 500 dorkies"


### Discussion #191 by @BeanieBlossom
> **Author:** [@BeanieBlossom](https://x.com/BeanieBlossom)  
> **Metrics:** 9 likes · 0 retweets · 5 comments · 118 views  

> **Posted:** 2026-09-29T19:26:02+00:00  


> **Source Link:** [https://x.com/BeanieBlossom/status/2105016268915085779](https://x.com/BeanieBlossom/status/2105016268915085779)  


> 
> "Good night, you lovely people

Under the moon's gentle watch, even the most unlikely friends find peace.

#GoodNight #AIArtWork #AIArt #AIArtists #AIArtCommunity"


### Discussion #192 by @WhiteGrape19
> **Author:** [@WhiteGrape19](https://x.com/WhiteGrape19)  
> **Metrics:** 5 likes · 1 retweets · 3 comments · 116 views  

> **Posted:** 2026-09-29T19:39:00+00:00  


> **Source Link:** [https://x.com/WhiteGrape19/status/2105019531592700361](https://x.com/WhiteGrape19/status/2105019531592700361)  


> 
> "野狗"


### Discussion #193 by @PPilotDeviation
> **Author:** [@PPilotDeviation](https://x.com/PPilotDeviation)  
> **Metrics:** 3 likes · 1 retweets · 1 comments · 114 views  

> **Posted:** 2026-09-29T18:16:19+00:00  


> **Source Link:** [https://x.com/PPilotDeviation/status/2104998723541741817](https://x.com/PPilotDeviation/status/2104998723541741817)  


> **Visual Context:** Two plastic cups filled with a creamy dessert sit on a counter next to a bottle of Maple Grove Farms Pure Maple Syrup.  

> 
> "2 quarts of homemade maple walnut ice cream, ready to set up in the freezer for several hours.

Simple ingredients: milk, heavy cream, sugar, pure maple syrup, salt, vanilla beans, and walnuts.

Taste better than store bought and only takes about 30 mins to make."


### Discussion #194 by @verbove
> **Author:** [@verbove](https://x.com/verbove)  
> **Metrics:** 5 likes · 0 retweets · 0 comments · 111 views  

> **Posted:** 2026-09-29T18:59:29+00:00  


> **Source Link:** [https://x.com/verbove/status/2105009586587726174](https://x.com/verbove/status/2105009586587726174)  


> 
> "your life is in your keeping alone

own it fully
become everything you ever wanted

build your dreams
show the world

 MakerMap"


### Discussion #195 by @magneticado
> **Author:** [@magneticado](https://x.com/magneticado)  
> **Metrics:** 13 likes · 5 retweets · 0 comments · 110 views  

> **Posted:** 2026-09-29T19:31:28+00:00  


> **Source Link:** [https://x.com/magneticado/status/2105017637432693013](https://x.com/magneticado/status/2105017637432693013)  


> 
> ""hate bas-""


### Discussion #196 by @HeyRoqeeb
> **Author:** [@HeyRoqeeb](https://x.com/HeyRoqeeb)  
> **Metrics:** 2 likes · 0 retweets · 2 comments · 110 views  

> **Posted:** 2026-09-29T17:40:48+00:00  


> **Source Link:** [https://x.com/HeyRoqeeb/status/2104989787581186418](https://x.com/HeyRoqeeb/status/2104989787581186418)  


> 
> "Eligible 
lfg"


### Discussion #197 by @ThePatrickPryor
> **Author:** [@ThePatrickPryor](https://x.com/ThePatrickPryor)  
> **Metrics:** 1 likes · 0 retweets · 0 comments · 108 views  

> **Posted:** 2026-09-29T18:04:32+00:00  


> **Source Link:** [https://x.com/ThePatrickPryor/status/2104995759531954284](https://x.com/ThePatrickPryor/status/2104995759531954284)  


> 
> "I'm back!"


### Discussion #198 by @nachovarga_X
> **Author:** [@nachovarga_X](https://x.com/nachovarga_X)  
> **Metrics:** 3 likes · 1 retweets · 1 comments · 106 views  

> **Posted:** 2026-09-29T19:03:15+00:00  


> **Source Link:** [https://x.com/nachovarga_X/status/2105010534399738083](https://x.com/nachovarga_X/status/2105010534399738083)  


> 
> "Baseceptor"


### Discussion #199 by @midwit
> **Author:** [@midwit](https://x.com/midwit)  
> **Metrics:** 3 likes · 0 retweets · 1 comments · 106 views  

> **Posted:** 2026-09-29T19:00:40+00:00  


> **Source Link:** [https://x.com/midwit/status/2105009884890911046](https://x.com/midwit/status/2105009884890911046)  


> 
> "checks out from here"


### Discussion #200 by @MensajesLuz
> **Author:** [@MensajesLuz](https://x.com/MensajesLuz)  
> **Metrics:** 1 likes · 0 retweets · 0 comments · 106 views  

> **Posted:** 2026-09-29T19:19:33+00:00  


> **Source Link:** [https://x.com/MensajesLuz/status/2105014638630838690](https://x.com/MensajesLuz/status/2105014638630838690)  


> 
> "Feliz y Bendecido Martes..."


### Discussion #201 by @SOY_SUSY_SONRIE
> **Author:** [@SOY_SUSY_SONRIE](https://x.com/SOY_SUSY_SONRIE)  
> **Metrics:** 8 likes · 3 retweets · 1 comments · 104 views  

> **Posted:** 2026-09-29T19:18:00+00:00  


> **Source Link:** [https://x.com/SOY_SUSY_SONRIE/status/2105014245876507059](https://x.com/SOY_SUSY_SONRIE/status/2105014245876507059)  


> **Visual Context:** A warm-toned image of a coffee cup surrounded by coffee beans and macarons, overlaid with the Spanish text '¡Buenas tardes! espero todo marche de maravillas...'  

> 
> "A la mañana lluvia...
A la tarde sol  
Tiempo loco 
Es la hora del café"


### Discussion #202 by @reddit
> **Author:** [@reddit](https://x.com/reddit)  
> **Metrics:** 1 likes · 0 retweets · 5 comments · 100 views  

> **Posted:** 2026-09-28T14:05:29.977000+00:00  



> 
> "Enduit et isolation respirante pour mur en brique naturelle

Popular on Reddit right now"


### Discussion #203 by @reddit
> **Author:** [@reddit](https://x.com/reddit)  
> **Metrics:** 1 likes · 0 retweets · 0 comments · 100 views  

> **Posted:** 2026-09-29T19:50:58.882000+00:00  



> 
> "Could you imagine"


### Discussion #204 by @arinamoroll
> **Author:** [@arinamoroll](https://x.com/arinamoroll)  
> **Metrics:** 2 likes · 0 retweets · 1 comments · 99 views  

> **Posted:** 2026-09-29T19:05:14+00:00  


> **Source Link:** [https://x.com/arinamoroll/status/2105011032834076775](https://x.com/arinamoroll/status/2105011032834076775)  


> 
> "what rhe hell"


### Discussion #205 by @Arixold
> **Author:** [@Arixold](https://x.com/Arixold)  
> **Metrics:** 11 likes · 0 retweets · 9 comments · 98 views  

> **Posted:** 2026-09-29T19:24:05+00:00  


> **Source Link:** [https://x.com/Arixold/status/2105015778177364152](https://x.com/Arixold/status/2105015778177364152)  


> **Visual Context:** An anime-style illustration of a blue-haired male character wearing headphones around his neck, sitting at a desk with a laptop in a dimly lit room with a moon visible through the window.  

> 
> "GN Everyone 

See U tomorrow"


### Discussion #206 by @matterAfactART
> **Author:** [@matterAfactART](https://x.com/matterAfactART)  
> **Metrics:** 5 likes · 0 retweets · 2 comments · 97 views  

> **Posted:** 2026-09-29T19:21:20+00:00  


> **Source Link:** [https://x.com/matterAfactART/status/2105015084351459840](https://x.com/matterAfactART/status/2105015084351459840)  


> **Visual Context:** A person wearing a metallic, spiked horned mask with a wide grinning mouth full of teeth poses against a red background.  

> 
> "Goooooood afternoon, everybody."


### Discussion #207 by @USConnect2021
> **Author:** [@USConnect2021](https://x.com/USConnect2021)  
> **Metrics:** 2 likes · 2 retweets · 3 comments · 97 views  

> **Posted:** 2026-09-29T19:24:32+00:00  


> **Source Link:** [https://x.com/USConnect2021/status/2105015890295288168](https://x.com/USConnect2021/status/2105015890295288168)  


> 
> "FOLLOW + LIKE  +  REPOST + NOTICES
@ShawnCrump4437
@magicial_ways
@USCONNECT2021
@CalmasiniJo
@calontheright
@calusaf
@CalvinH65426785
@calyeOB
@Cam_Medicine
@CameoQ42501
Please Repost So Everyone Grows Together"


### Discussion #208 by @PokerStarsON
> **Author:** [@PokerStarsON](https://x.com/PokerStarsON)  
> **Metrics:** 1 likes · 0 retweets · 0 comments · 95 views  

> **Posted:** 2026-09-29T18:45:00+00:00  


> **Source Link:** [https://x.com/PokerStarsON/status/2105005944111280371](https://x.com/PokerStarsON/status/2105005944111280371)  


> 
> "Getting paid with Aces."


### Discussion #209 by @LEOS10301
> **Author:** [@LEOS10301](https://x.com/LEOS10301)  
> **Metrics:** 4 likes · 1 retweets · 1 comments · 92 views  

> **Posted:** 2026-09-29T19:14:37+00:00  


> **Source Link:** [https://x.com/LEOS10301/status/2105013395858792509](https://x.com/LEOS10301/status/2105013395858792509)  


> 
> "Kicked off the auction for Nephomancy
by 
@EmiTrevisani
 . Unique and lovely. Sound on, the sound is beautiful."


### Discussion #210 by @A_MKennedy
> **Author:** [@A_MKennedy](https://x.com/A_MKennedy)  
> **Metrics:** 4 likes · 0 retweets · 0 comments · 92 views  

> **Posted:** 2026-09-29T19:23:50+00:00  


> **Source Link:** [https://x.com/A_MKennedy/status/2105015716348928122](https://x.com/A_MKennedy/status/2105015716348928122)  


> 
> "It’s him. Nothing to see here."


### Discussion #211 by @josepkingsley
> **Author:** [@josepkingsley](https://x.com/josepkingsley)  
> **Metrics:** 6 likes · 3 retweets · 0 comments · 90 views  

> **Posted:** 2026-09-29T18:49:08+00:00  


> **Source Link:** [https://x.com/josepkingsley/status/2105006982629605657](https://x.com/josepkingsley/status/2105006982629605657)  


> 
> "Moon rn"


### Discussion #212 by @bristiathome
> **Author:** [@bristiathome](https://x.com/bristiathome)  
> **Metrics:** 4 likes · 0 retweets · 0 comments · 88 views  

> **Posted:** 2026-09-29T18:51:51+00:00  


> **Source Link:** [https://x.com/bristiathome/status/2105007666699661428](https://x.com/bristiathome/status/2105007666699661428)  


> **Visual Context:** A shirtless man in blue jeans leaning on the wooden railing of a boat on a lake with a forested shoreline in the background.  

> 
> "Going to sleep early yall good and san's back night to everyoneee"


### Discussion #213 by @jurubis
> **Author:** [@jurubis](https://x.com/jurubis)  
> **Metrics:** 2 likes · 1 retweets · 2 comments · 88 views  

> **Posted:** 2026-09-29T17:55:37+00:00  


> **Source Link:** [https://x.com/jurubis/status/2104993513670586769](https://x.com/jurubis/status/2104993513670586769)  


> 
> "GA 
Wallpaper"


### Discussion #214 by @chaengsfiance
> **Author:** [@chaengsfiance](https://x.com/chaengsfiance)  
> **Metrics:** 3 likes · 0 retweets · 0 comments · 87 views  

> **Posted:** 2026-09-29T18:58:54+00:00  


> **Source Link:** [https://x.com/chaengsfiance/status/2105009440776949944](https://x.com/chaengsfiance/status/2105009440776949944)  


> **Visual Context:** A 3D render of a cat wearing a safari hat, holding a croissant in one paw and a patterned paper coffee cup in the other.  

> 
> "I want a snack"


### Discussion #215 by @jing7141
> **Author:** [@jing7141](https://x.com/jing7141)  
> **Metrics:** 2 likes · 0 retweets · 1 comments · 85 views  

> **Posted:** 2026-09-29T18:57:43+00:00  


> **Source Link:** [https://x.com/jing7141/status/2105009143782551911](https://x.com/jing7141/status/2105009143782551911)  


> 
> "孤独喵"


### Discussion #216 by @kamenosuke_8
> **Author:** [@kamenosuke_8](https://x.com/kamenosuke_8)  
> **Metrics:** 2 likes · 0 retweets · 1 comments · 83 views  

> **Posted:** 2026-09-29T18:10:14+00:00  


> **Source Link:** [https://x.com/kamenosuke_8/status/2104997191643550171](https://x.com/kamenosuke_8/status/2104997191643550171)  


> 
> "すんごいっイカ釣れてどうやってあげよーって迷ってたら目の前でポトって落ちたよ
次は釣ろうねっ#クソがっ"


### Discussion #217 by @sol_free_xxx
> **Author:** [@sol_free_xxx](https://x.com/sol_free_xxx)  
> **Metrics:** 2 likes · 0 retweets · 0 comments · 83 views  

> **Posted:** 2026-09-29T18:30:56+00:00  


> **Source Link:** [https://x.com/sol_free_xxx/status/2105002400616730921](https://x.com/sol_free_xxx/status/2105002400616730921)  


> 
> "ケミストリー#sangtacare#sangtsangt 
#Acare_ct"


### Discussion #218 by @DeeRod
> **Author:** [@DeeRod](https://x.com/DeeRod)  
> **Metrics:** 6 likes · 1 retweets · 1 comments · 82 views  

> **Posted:** 2026-09-29T17:54:24+00:00  


> **Source Link:** [https://x.com/DeeRod/status/2104993206999867861](https://x.com/DeeRod/status/2104993206999867861)  


> 
> "I think so... 

why not...."


### Discussion #219 by @GigaJaxx
> **Author:** [@GigaJaxx](https://x.com/GigaJaxx)  
> **Metrics:** 7 likes · 0 retweets · 0 comments · 81 views  

> **Posted:** 2026-09-29T18:49:43+00:00  


> **Source Link:** [https://x.com/GigaJaxx/status/2105007131304817065](https://x.com/GigaJaxx/status/2105007131304817065)  


> 
> "There’s alpha in this photo…"


### Discussion #220 by @NeffeliesStuff
> **Author:** [@NeffeliesStuff](https://x.com/NeffeliesStuff)  
> **Metrics:** 3 likes · 0 retweets · 0 comments · 79 views  

> **Posted:** 2026-09-29T19:18:00+00:00  


> **Source Link:** [https://x.com/NeffeliesStuff/status/2105014246689923323](https://x.com/NeffeliesStuff/status/2105014246689923323)  


> 
> "So pretty!!"


### Discussion #221 by @USConnect2021
> **Author:** [@USConnect2021](https://x.com/USConnect2021)  
> **Metrics:** 2 likes · 1 retweets · 0 comments · 79 views  

> **Posted:** 2026-09-29T19:39:54+00:00  


> **Source Link:** [https://x.com/USConnect2021/status/2105019758383186312](https://x.com/USConnect2021/status/2105019758383186312)  


> 
> "FOLLOW + REPOST + NOTICES
@usconnect2021
@nanahendrix66
@805Raiderfan
@TODD4USA
@peekaa
@ric_dallas
@ShawnCrump4437
@122362FU
@CarrieB78357467
@carryingmarine
@Carter_MAGA
@carynannharlos
@cashmymemes
@CASievers55
@CaspersonFred
@cassianus_mor
@CassieDPearson8
@cat_barnes30
PLZ"


### Discussion #222 by @riammstrongs
> **Author:** [@riammstrongs](https://x.com/riammstrongs)  
> **Metrics:** 9 likes · 3 retweets · 0 comments · 78 views  

> **Posted:** 2026-09-29T19:25:17+00:00  


> **Source Link:** [https://x.com/riammstrongs/status/2105016081740141020](https://x.com/riammstrongs/status/2105016081740141020)  


> 
> "Talk about Becky in the morning, talk about Becky at night, talk about Becky all day long… but never stop talking about Becky Armstrong"


### Discussion #223 by @KKOyamahq
> **Author:** [@KKOyamahq](https://x.com/KKOyamahq)  
> **Metrics:** 2 likes · 0 retweets · 0 comments · 78 views  

> **Posted:** 2026-09-29T17:51:18+00:00  


> **Source Link:** [https://x.com/KKOyamahq/status/2104992429074223572](https://x.com/KKOyamahq/status/2104992429074223572)  


> **Visual Context:** A Japanese advertisement for a Thai massage, oil, and men's esthetic service in Itabashi, Oyama Taiki, featuring two staff members named Mina (ミナ) and Miki (ミキ), open from 12:00 to 25:00 with a 1000 yen discount until 18:00.  

> 
> "9月30日"


### Discussion #224 by @Literatureomar
> **Author:** [@Literatureomar](https://x.com/Literatureomar)  
> **Metrics:** 1 likes · 1 retweets · 0 comments · 77 views  

> **Posted:** 2026-09-29T19:14:25+00:00  


> **Source Link:** [https://x.com/Literatureomar/status/2105013344587448387](https://x.com/Literatureomar/status/2105013344587448387)  


> 
> "I heard a quote today that said: Every storm has two purposes. To destroy what isn't solid, and to reveal what is.
And it healed me a little."


### Discussion #225 by @greedyrayy
> **Author:** [@greedyrayy](https://x.com/greedyrayy)  
> **Metrics:** 2 likes · 0 retweets · 0 comments · 75 views  

> **Posted:** 2026-09-29T19:27:01+00:00  


> **Source Link:** [https://x.com/greedyrayy/status/2105016518501417218](https://x.com/greedyrayy/status/2105016518501417218)  


> 
> "ur not a good boy if you don’t have my post notifications on"


### Discussion #226 by @SDEOSKAR
> **Author:** [@SDEOSKAR](https://x.com/SDEOSKAR)  
> **Metrics:** 3 likes · 0 retweets · 6 comments · 72 views  

> **Posted:** 2026-09-29T18:07:43+00:00  


> **Source Link:** [https://x.com/SDEOSKAR/status/2104996558760747218](https://x.com/SDEOSKAR/status/2104996558760747218)  


> 
> "梁溪区，今晚把你所有敏感的地方，都弄得又红又肿。#无锡"


### Discussion #227 by @USConnect2021
> **Author:** [@USConnect2021](https://x.com/USConnect2021)  
> **Metrics:** 2 likes · 2 retweets · 0 comments · 71 views  

> **Posted:** 2026-09-29T19:23:19+00:00  


> **Source Link:** [https://x.com/USConnect2021/status/2105015586812293370](https://x.com/USConnect2021/status/2105015586812293370)  


> 
> "FOLLOW + LIKE  +  REPOST + NOTICES
@ShawnCrump4437
@magicial_ways
@USCONNECT2021
@candace_lo70387
@canderson93
@CanDiva77
@candle_snob
@CandyJerseyGirl
@candyjk0010
@Cane92R
Please Repost So Everyone Grows Together"


### Discussion #228 by @Slayerx1323
> **Author:** [@Slayerx1323](https://x.com/Slayerx1323)  
> **Metrics:** 4 likes · 1 retweets · 0 comments · 70 views  

> **Posted:** 2026-09-29T19:01:34+00:00  


> **Source Link:** [https://x.com/Slayerx1323/status/2105010111018123288](https://x.com/Slayerx1323/status/2105010111018123288)  


> 
> "Binx and Oreo"


### Discussion #229 by @EA_LM1978
> **Author:** [@EA_LM1978](https://x.com/EA_LM1978)  
> **Metrics:** 1 likes · 0 retweets · 0 comments · 70 views  

> **Posted:** 2026-09-29T18:29:59+00:00  


> **Source Link:** [https://x.com/EA_LM1978/status/2105002161587585077](https://x.com/EA_LM1978/status/2105002161587585077)  


> 
> "MARATÓN DE SEGUIDORES PARA
CUENTAS CON MENOS DE 10 K 

♡⃝Aumenta de seguidores en 𝕏

Da Rp's
Comenta
Siga los Rp's y comentarios
Toma la iniciativa de seguir
Regresa el seguimiento

 Seguimiento Mutuo

 Sígueme, interactua y te sigo"


### Discussion #230 by @raorane_raj
> **Author:** [@raorane_raj](https://x.com/raorane_raj)  
> **Metrics:** 3 likes · 0 retweets · 3 comments · 68 views  

> **Posted:** 2026-09-29T18:03:45+00:00  


> **Source Link:** [https://x.com/raorane_raj/status/2104995562420670471](https://x.com/raorane_raj/status/2104995562420670471)  


> 
> "Go find yourself!"


### Discussion #231 by @EditorSola
> **Author:** [@EditorSola](https://x.com/EditorSola)  
> **Metrics:** 2 likes · 0 retweets · 0 comments · 65 views  

> **Posted:** 2026-09-29T18:57:58+00:00  


> **Source Link:** [https://x.com/EditorSola/status/2105009206990356680](https://x.com/EditorSola/status/2105009206990356680)  


> 
> "Trial reel, thoughts?"


### Discussion #232 by @ttiimmees
> **Author:** [@ttiimmees](https://x.com/ttiimmees)  
> **Metrics:** 1 likes · 0 retweets · 0 comments · 65 views  

> **Posted:** 2026-09-29T19:37:42+00:00  


> **Source Link:** [https://x.com/ttiimmees/status/2105019202939781387](https://x.com/ttiimmees/status/2105019202939781387)  


> **Visual Context:** A digital collage artwork featuring a man's face on the left and a pair of high-heeled boots made of a colorful, glitch-like cityscape pattern on the right, with smoke rising behind them.  

> 
> "us:"


### Discussion #233 by @sunlifefl
> **Author:** [@sunlifefl](https://x.com/sunlifefl)  
> **Metrics:** 4 likes · 0 retweets · 0 comments · 63 views  

> **Posted:** 2026-09-29T16:00:35+00:00  


> **Source Link:** [https://x.com/sunlifefl/status/2104964563812667775](https://x.com/sunlifefl/status/2104964563812667775)  


> **Visual Context:** A person in a light blue tank top sits against a wicker chair, showing visible sunburn on their chest and neck.  

> 
> "#newprofilepic"


### Discussion #234 by @blindflightstd
> **Author:** [@blindflightstd](https://x.com/blindflightstd)  
> **Metrics:** 2 likes · 0 retweets · 1 comments · 62 views  

> **Posted:** 2026-09-29T18:04:59+00:00  


> **Source Link:** [https://x.com/blindflightstd/status/2104995873025413196](https://x.com/blindflightstd/status/2104995873025413196)  


> 
> "Such an amazing person!
Please do follow him and support his efforts"


### Discussion #235 by @lanbisalya
> **Author:** [@lanbisalya](https://x.com/lanbisalya)  
> **Metrics:** 10 likes · 0 retweets · 1 comments · 60 views  

> **Posted:** 2026-09-29T19:53:29+00:00  


> **Source Link:** [https://x.com/lanbisalya/status/2105023177651044811](https://x.com/lanbisalya/status/2105023177651044811)  


> 
> "Bişe dicem sizi hiç geleyim 5 dk göreyim diyecek kadar sevdiler mi?"


### Discussion #236 by @v3lv3tdrag0n
> **Author:** [@v3lv3tdrag0n](https://x.com/v3lv3tdrag0n)  
> **Metrics:** 4 likes · 0 retweets · 1 comments · 55 views  

> **Posted:** 2026-09-29T19:28:58+00:00  


> **Source Link:** [https://x.com/v3lv3tdrag0n/status/2105017006273728700](https://x.com/v3lv3tdrag0n/status/2105017006273728700)  


> **Visual Context:** A circular arrangement of cartoon-style avatars with the text '@v3lv3tdrag0n X circle, 29 Sep 2026' in the bottom left and 'cut-noodle.com/x-circle' in the bottom right.  

> 
> "i really love all these little people ♡"


### Discussion #237 by @Chaecarioca
> **Author:** [@Chaecarioca](https://x.com/Chaecarioca)  
> **Metrics:** 2 likes · 0 retweets · 0 comments · 54 views  

> **Posted:** 2026-09-29T19:27:17+00:00  


> **Source Link:** [https://x.com/Chaecarioca/status/2105016584653652287](https://x.com/Chaecarioca/status/2105016584653652287)  


> **Visual Context:** A JYP Entertainment official photo showing a blonde K-pop idol with her arm outstretched, smiling against a blue sky background, with the 'JYP OFFICIAL' watermark.  

> 
> "Deve"


### Discussion #238 by @toycompany_mew
> **Author:** [@toycompany_mew](https://x.com/toycompany_mew)  
> **Metrics:** 2 likes · 0 retweets · 0 comments · 53 views  

> **Posted:** 2026-09-29T17:53:12+00:00  


> **Source Link:** [https://x.com/toycompany_mew/status/2104992906490831048](https://x.com/toycompany_mew/status/2104992906490831048)  


> **Visual Context:** A screenshot from a Japanese TV program showing a blonde idol with twin tails surrounded by a glowing yellow aura, with Japanese text promoting a free NFT giveaway.  

> 
> "発光めう"


### Discussion #239 by @vjcentero
> **Author:** [@vjcentero](https://x.com/vjcentero)  
> **Metrics:** 1 likes · 1 retweets · 1 comments · 52 views  

> **Posted:** 2026-09-29T19:15:44+00:00  


> **Source Link:** [https://x.com/vjcentero/status/2105013675257991217](https://x.com/vjcentero/status/2105013675257991217)  


> 
> ""TESTING_/AI12_#11" 
@DV_gh0st"


### Discussion #240 by @seabun_nie
> **Author:** [@seabun_nie](https://x.com/seabun_nie)  
> **Metrics:** 1 likes · 0 retweets · 0 comments · 52 views  

> **Posted:** 2026-09-29T18:40:38+00:00  


> **Source Link:** [https://x.com/seabun_nie/status/2105004842766696935](https://x.com/seabun_nie/status/2105004842766696935)  


> **Visual Context:** A side-by-side comparison shows a 3D model render and sculpted figurine of an anime-style character, appearing to be a Jinx cosplay figure, sitting on an amplifier.  

> 
> "Voy a ir comprando el frasquito tmb"


### Discussion #241 by @hwsiee
> **Author:** [@hwsiee](https://x.com/hwsiee)  
> **Metrics:** 2 likes · 0 retweets · 0 comments · 51 views  

> **Posted:** 2026-09-29T18:38:32+00:00  


> **Source Link:** [https://x.com/hwsiee/status/2105004317107245141](https://x.com/hwsiee/status/2105004317107245141)  


> 
> "whatever you say beautiful"


### Discussion #242 by @tagato2626
> **Author:** [@tagato2626](https://x.com/tagato2626)  
> **Metrics:** 1 likes · 0 retweets · 0 comments · 51 views  

> **Posted:** 2026-09-29T18:39:56+00:00  


> **Source Link:** [https://x.com/tagato2626/status/2105004666706960605](https://x.com/tagato2626/status/2105004666706960605)  


> 
> "答えは一律じゃないのよね
#いぎありん"


### Discussion #243 by @yun1stfan
> **Author:** [@yun1stfan](https://x.com/yun1stfan)  
> **Metrics:** 3 likes · 0 retweets · 1 comments · 47 views  

> **Posted:** 2026-09-29T18:25:00+00:00  


> **Source Link:** [https://x.com/yun1stfan/status/2105000908824477941](https://x.com/yun1stfan/status/2105000908824477941)  


> **Visual Context:** Two photocards of a female K-pop idol alongside an official 'T.J.T ASSOCIATION' member ID card identifying 'SAKI', issued '08.24.2026', for 'TTTA' in 'TUNA BPOW'.  

> 
> "será que alguém compraria?"


### Discussion #244 by @cinna_apple_pie
> **Author:** [@cinna_apple_pie](https://x.com/cinna_apple_pie)  
> **Metrics:** 3 likes · 0 retweets · 1 comments · 46 views  

> **Posted:** 2026-09-29T19:27:25+00:00  


> **Source Link:** [https://x.com/cinna_apple_pie/status/2105016617843220897](https://x.com/cinna_apple_pie/status/2105016617843220897)  


> 
> "HELLO????"


### Discussion #245 by @MegapotDaily
> **Author:** [@MegapotDaily](https://x.com/MegapotDaily)  
> **Metrics:** 2 likes · 0 retweets · 1 comments · 46 views  

> **Posted:** 2026-09-29T18:39:23+00:00  


> **Source Link:** [https://x.com/MegapotDaily/status/2105004530630840393](https://x.com/MegapotDaily/status/2105004530630840393)  


> 
> "The results for 
@megapot
 Draw #189 are now LIVE!

 THE PENDULUM OBEYED & 25 CONFIRMED ITS STREAK! 

Today, statistical physics proved us right: we escaped the basement, and a Dark Legend gave us a masterclass.

 Results, statistics, trends, and key data."


### Discussion #246 by @mimiininii1
> **Author:** [@mimiininii1](https://x.com/mimiininii1)  
> **Metrics:** 1 likes · 0 retweets · 0 comments · 46 views  

> **Posted:** 2026-09-29T19:46:26+00:00  


> **Source Link:** [https://x.com/mimiininii1/status/2105021404303520200](https://x.com/mimiininii1/status/2105021404303520200)  


> 
> "i wanna be there"


### Discussion #247 by @CharBolen
> **Author:** [@CharBolen](https://x.com/CharBolen)  
> **Metrics:** 3 likes · 7 retweets · 2 comments · 42 views  

> **Posted:** 2026-09-29T19:30:20+00:00  


> **Source Link:** [https://x.com/CharBolen/status/2105017353025024129](https://x.com/CharBolen/status/2105017353025024129)  


> **Visual Context:** A muscular gray dog, possibly a Cane Corso, stands on pavement on a leash with its tongue out, next to a car wheel and a person's legs.  

> 
> "PLEASE SAVE THIS POOR GIRL ON KILL 
COMMAND  
SHE NEEDS HELP RIGHT NOW OUT OF TIME 
SHE'S HEARTBROKEN AND FRIGHTENED  
PLEASE HELP HER"


### Discussion #248 by @__Aneef
> **Author:** [@__Aneef](https://x.com/__Aneef)  
> **Metrics:** 3 likes · 1 retweets · 1 comments · 42 views  

> **Posted:** 2026-09-29T18:38:44+00:00  


> **Source Link:** [https://x.com/__Aneef/status/2105004365140648066](https://x.com/__Aneef/status/2105004365140648066)  


> 
> "We can only dream of this now"


### Discussion #249 by @VieNatureSavoir
> **Author:** [@VieNatureSavoir](https://x.com/VieNatureSavoir)  
> **Metrics:** 3 likes · 0 retweets · 1 comments · 41 views  

> **Posted:** 2026-09-29T19:49:19+00:00  


> **Source Link:** [https://x.com/VieNatureSavoir/status/2105022126499442760](https://x.com/VieNatureSavoir/status/2105022126499442760)  


> 
> "Good night"


### Discussion #250 by @VibesAqua78475
> **Author:** [@VibesAqua78475](https://x.com/VibesAqua78475)  
> **Metrics:** 2 likes · 1 retweets · 0 comments · 41 views  

> **Posted:** 2026-09-29T19:28:41+00:00  


> **Source Link:** [https://x.com/VibesAqua78475/status/2105016934727119307](https://x.com/VibesAqua78475/status/2105016934727119307)  


> 
> "OMG"


### Discussion #251 by @debscrochet
> **Author:** [@debscrochet](https://x.com/debscrochet)  
> **Metrics:** 2 likes · 2 retweets · 0 comments · 40 views  

> **Posted:** 2026-09-29T18:38:18+00:00  


> **Source Link:** [https://x.com/debscrochet/status/2105004257619673127](https://x.com/debscrochet/status/2105004257619673127)  


> 
> "Large Crocheted Storage Basket Colorful Tote Heavy Duty Laundry Bag 17x14"


### Discussion #252 by @Amir_Radarit
> **Author:** [@Amir_Radarit](https://x.com/Amir_Radarit)  
> **Metrics:** 4 likes · 0 retweets · 0 comments · 39 views  

> **Posted:** 2026-09-29T19:25:46+00:00  


> **Source Link:** [https://x.com/Amir_Radarit/status/2105016201055482128](https://x.com/Amir_Radarit/status/2105016201055482128)  


> 
> "Brick after brick lands on wet mortar while four arms keep a wall growing.

Mortar bead sits wet and gray along the top course. Wall of red clay rises straight beside the tracked base.

Wall already stands several courses high with even joints. Track of the machine rolls slowly"


### Discussion #253 by @lizsanyaa
> **Author:** [@lizsanyaa](https://x.com/lizsanyaa)  
> **Metrics:** 1 likes · 1 retweets · 1 comments · 39 views  

> **Posted:** 2026-09-29T19:26:46+00:00  


> **Source Link:** [https://x.com/lizsanyaa/status/2105016452957032656](https://x.com/lizsanyaa/status/2105016452957032656)  


> 
> "ISIT TIME"


### Discussion #254 by @renee75gf2
> **Author:** [@renee75gf2](https://x.com/renee75gf2)  
> **Metrics:** 1 likes · 0 retweets · 0 comments · 39 views  

> **Posted:** 2026-09-29T17:53:50+00:00  


> **Source Link:** [https://x.com/renee75gf2/status/2104993066079944775](https://x.com/renee75gf2/status/2104993066079944775)  


> 
> "想看大肉棒
严肃品鉴 #肉棒 #鸡巴"


### Discussion #255 by @FFMEC2
> **Author:** [@FFMEC2](https://x.com/FFMEC2)  
> **Metrics:** 1 likes · 0 retweets · 0 comments · 38 views  

> **Posted:** 2026-09-29T19:31:32+00:00  


> **Source Link:** [https://x.com/FFMEC2/status/2105017652225720758](https://x.com/FFMEC2/status/2105017652225720758)  


> 
> "Yesss"


### Discussion #256 by @gisellecitou
> **Author:** [@gisellecitou](https://x.com/gisellecitou)  
> **Metrics:** 1 likes · 0 retweets · 0 comments · 38 views  

> **Posted:** 2026-09-29T19:07:53+00:00  


> **Source Link:** [https://x.com/gisellecitou/status/2105011702379040827](https://x.com/gisellecitou/status/2105011702379040827)  


> 
> "ela com a aliança q eu dei de presente quando vi ela no shopping kk te amo amor"


### Discussion #257 by @MikeAndes4
> **Author:** [@MikeAndes4](https://x.com/MikeAndes4)  
> **Metrics:** 1 likes · 0 retweets · 0 comments · 38 views  

> **Posted:** 2026-09-29T18:58:24+00:00  


> **Source Link:** [https://x.com/MikeAndes4/status/2105009314251366675](https://x.com/MikeAndes4/status/2105009314251366675)  


> 
> "Costly Mistakes on the Vans"


### Discussion #258 by @NiziUrang
> **Author:** [@NiziUrang](https://x.com/NiziUrang)  
> **Metrics:** 2 likes · 0 retweets · 0 comments · 37 views  

> **Posted:** 2026-09-29T19:34:46+00:00  


> **Source Link:** [https://x.com/NiziUrang/status/2105018465878945801](https://x.com/NiziUrang/status/2105018465878945801)  


> 
> "emoji"


### Discussion #259 by @dilocondibujos_
> **Author:** [@dilocondibujos_](https://x.com/dilocondibujos_)  
> **Metrics:** 0 likes · 0 retweets · 0 comments · 37 views  

> **Posted:** 2026-09-29T19:53:42+00:00  


> **Source Link:** [https://x.com/dilocondibujos_/status/2105023231715344817](https://x.com/dilocondibujos_/status/2105023231715344817)  


> 
> "Buenos datos"


### Discussion #260 by @lunarnabi
> **Author:** [@lunarnabi](https://x.com/lunarnabi)  
> **Metrics:** 5 likes · 0 retweets · 0 comments · 34 views  

> **Posted:** 2026-09-29T19:01:49+00:00  


> **Source Link:** [https://x.com/lunarnabi/status/2105010173240889411](https://x.com/lunarnabi/status/2105010173240889411)  


> **Visual Context:** A backstage moment marked @BABYMETAL_OFFICIAL shows a woman with a halo hair accessory tending to a child in a wagon while another child watches.  

> 
> "Babies with a baby"


### Discussion #261 by @Xsmom15
> **Author:** [@Xsmom15](https://x.com/Xsmom15)  
> **Metrics:** 1 likes · 0 retweets · 0 comments · 34 views  

> **Posted:** 2026-09-29T18:27:37+00:00  


> **Source Link:** [https://x.com/Xsmom15/status/2105001566440964262](https://x.com/Xsmom15/status/2105001566440964262)  


> 
> "Love this so much"


### Discussion #262 by @_AMASTAGE_satsu
> **Author:** [@_AMASTAGE_satsu](https://x.com/_AMASTAGE_satsu)  
> **Metrics:** 1 likes · 0 retweets · 0 comments · 34 views  

> **Posted:** 2026-09-29T18:25:01+00:00  


> **Source Link:** [https://x.com/_AMASTAGE_satsu/status/2105000913098453279](https://x.com/_AMASTAGE_satsu/status/2105000913098453279)  


> 
> "325変な時間に起きて寝れなくﾅﾀ〜"


### Discussion #263 by @oncesu66
> **Author:** [@oncesu66](https://x.com/oncesu66)  
> **Metrics:** 1 likes · 0 retweets · 0 comments · 34 views  

> **Posted:** 2026-09-29T18:21:16+00:00  


> **Source Link:** [https://x.com/oncesu66/status/2104999969874755895](https://x.com/oncesu66/status/2104999969874755895)  


> **Visual Context:** A young woman with long dark hair, wearing a black crop top and jeans, sings into a microphone on stage while pointing at the audience, who are holding glowing light sticks.  

> 
> "yerp"


### Discussion #264 by @Usmanmughalz
> **Author:** [@Usmanmughalz](https://x.com/Usmanmughalz)  
> **Metrics:** 1 likes · 0 retweets · 1 comments · 34 views  

> **Posted:** 2026-09-29T18:54:56+00:00  


> **Source Link:** [https://x.com/Usmanmughalz/status/2105008443598012613](https://x.com/Usmanmughalz/status/2105008443598012613)  


> **Visual Context:** Four rectangular outlines on a purple background, with the letter 'D' in the first box and a small black-and-white image of a goat or animal in the second box.  

> 
> "Can you make a four letter word?"


### Discussion #265 by @korbxisca
> **Author:** [@korbxisca](https://x.com/korbxisca)  
> **Metrics:** 2 likes · 0 retweets · 0 comments · 33 views  

> **Posted:** 2026-09-29T18:20:59+00:00  


> **Source Link:** [https://x.com/korbxisca/status/2104999900228583767](https://x.com/korbxisca/status/2104999900228583767)  


> 
> "ซานะลืมทำมิชชั่นระหว่างทัวร์ คือมันง่ายแหละ แค่ลืมมมไปเลย เพื่อนๆ กำลังจะเห้อมมม55555555 แต่น้องมินะช่วยว่าอาจจะง่ายจนลืม เพราะของน้องมินะยากจนท้อ ทำไงดี (แต่ผ่านนะ เอ้า555555) น่ารักกก"


### Discussion #266 by @vjcentero
> **Author:** [@vjcentero](https://x.com/vjcentero)  
> **Metrics:** 1 likes · 1 retweets · 1 comments · 29 views  

> **Posted:** 2026-09-29T19:23:04+00:00  


> **Source Link:** [https://x.com/vjcentero/status/2105015521326301288](https://x.com/vjcentero/status/2105015521326301288)  


> 
> ""tz001" 
@xicojam"


### Discussion #267 by @seahawkgirl84
> **Author:** [@seahawkgirl84](https://x.com/seahawkgirl84)  
> **Metrics:** 1 likes · 0 retweets · 0 comments · 29 views  

> **Posted:** 2026-09-29T19:46:03+00:00  


> **Source Link:** [https://x.com/seahawkgirl84/status/2105021305154052430](https://x.com/seahawkgirl84/status/2105021305154052430)  


> 
> "QT your Image and Artist
tfti 
@conley_presnell
 & 
@BeanieBlossom
 

@rHinoSyth
 @BlueflowerNew22"


### Discussion #268 by @Bijon_BB
> **Author:** [@Bijon_BB](https://x.com/Bijon_BB)  
> **Metrics:** 1 likes · 0 retweets · 0 comments · 27 views  

> **Posted:** 2026-09-29T19:43:51+00:00  


> **Source Link:** [https://x.com/Bijon_BB/status/2105020753364353365](https://x.com/Bijon_BB/status/2105020753364353365)  


> 
> "Ohh fkk"


### Discussion #269 by @5iveheartstw
> **Author:** [@5iveheartstw](https://x.com/5iveheartstw)  
> **Metrics:** 1 likes · 1 retweets · 0 comments · 26 views  

> **Posted:** 2026-09-29T18:05:58+00:00  


> **Source Link:** [https://x.com/5iveheartstw/status/2104996117813371099](https://x.com/5iveheartstw/status/2104996117813371099)  


> 
> "ㅤ
⠀ ⠀ ⠀ㅤ
⠀ ⠀ ⠀     ᅠᅠ ʜear𝐭 𖹭f 𝑤o𝕞an 
ᅠᅠᅠ          ᅠ  nē𝕨 𝖙𝕚к𝐭o𝕜ㅤ
⠀ ⠀ ⠀ㅤ
⠀ ⠀ ⠀"


### Discussion #270 by @Loveyoubye_x
> **Author:** [@Loveyoubye_x](https://x.com/Loveyoubye_x)  
> **Metrics:** 1 likes · 0 retweets · 0 comments · 25 views  

> **Posted:** 2026-09-29T19:04:27+00:00  


> **Source Link:** [https://x.com/Loveyoubye_x/status/2105010837861679593](https://x.com/Loveyoubye_x/status/2105010837861679593)  


> 
> "Come join the space"


### Discussion #271 by @bunjil
> **Author:** [@bunjil](https://x.com/bunjil)  
> **Metrics:** 0 likes · 0 retweets · 0 comments · 25 views  

> **Posted:** 2026-09-29T19:49:49+00:00  


> **Source Link:** [https://x.com/bunjil/status/2105022254232797641](https://x.com/bunjil/status/2105022254232797641)  


> 
> "My Carbonara tricks are:

- Make sauce in a large bowl
- Toast the black pepper in pan, then put in bowl
- Pour some of the pancetta/guanciale fat into the bowl
- Mix pasta + sauce (with some pasta water) in the cold sauce bowl, not the hot pan (stays creamy not cooked)"


### Discussion #272 by @miking_t
> **Author:** [@miking_t](https://x.com/miking_t)  
> **Metrics:** 2 likes · 1 retweets · 1 comments · 24 views  

> **Posted:** 2026-09-29T19:33:25+00:00  


> **Source Link:** [https://x.com/miking_t/status/2105018126232649742](https://x.com/miking_t/status/2105018126232649742)  


> 
> "The WORLD is ..."


### Discussion #273 by @ruilovenobnaga
> **Author:** [@ruilovenobnaga](https://x.com/ruilovenobnaga)  
> **Metrics:** 1 likes · 0 retweets · 0 comments · 23 views  

> **Posted:** 2026-09-29T19:19:30+00:00  


> **Source Link:** [https://x.com/ruilovenobnaga/status/2105014625544863790](https://x.com/ruilovenobnaga/status/2105014625544863790)  


> 
> "おはよう夢空ちゃん
10時間ぐらい寝ちゃった
今日もがんばろおね#星野夢空 #AsIs #アズイズ#ねえゆあた"


### Discussion #274 by @IvensJulia7356
> **Author:** [@IvensJulia7356](https://x.com/IvensJulia7356)  
> **Metrics:** 2 likes · 1 retweets · 2 comments · 22 views  

> **Posted:** 2026-09-29T18:31:50+00:00  


> **Source Link:** [https://x.com/IvensJulia7356/status/2105002630372286731](https://x.com/IvensJulia7356/status/2105002630372286731)  


> **Visual Context:** A cyberpunk-style digital illustration of a dark-haired character with green eyes wearing a face mask, surrounded by a glowing green halo and circuit-board patterns with Chinese characters and text like 'ACCESS GRANTED' and 'CHK-07'.  

> 
> "人肉搜索微信查实名以赛通话记录查外卖地址亚盗号查微信聊天记录查资料书查学籍查老赖"


### Discussion #275 by @thekangseulgi
> **Author:** [@thekangseulgi](https://x.com/thekangseulgi)  
> **Metrics:** 1 likes · 0 retweets · 1 comments · 22 views  

> **Posted:** 2026-09-29T19:35:54+00:00  


> **Source Link:** [https://x.com/thekangseulgi/status/2105018752748421630](https://x.com/thekangseulgi/status/2105018752748421630)  


> 
> "love this for me"


### Discussion #276 by @Lysergicore
> **Author:** [@Lysergicore](https://x.com/Lysergicore)  
> **Metrics:** 2 likes · 0 retweets · 1 comments · 20 views  

> **Posted:** 2026-09-29T19:45:28+00:00  


> **Source Link:** [https://x.com/Lysergicore/status/2105021158328287635](https://x.com/Lysergicore/status/2105021158328287635)  


> 
> "Good Night"


### Discussion #277 by @gabrieloota
> **Author:** [@gabrieloota](https://x.com/gabrieloota)  
> **Metrics:** 1 likes · 0 retweets · 0 comments · 20 views  

> **Posted:** 2026-09-29T18:17:10+00:00  


> **Source Link:** [https://x.com/gabrieloota/status/2104998939778826508](https://x.com/gabrieloota/status/2104998939778826508)  


> **Visual Context:** A collection of K-pop merchandise, including photocards and a photobook featuring a female idol with purple and dark hair, decorated with rhinestones and stickers.  

> 
> "feedback positivo pra 
@chaezction
 nas 2 Giselles 
tudo bem embaladinho, chegou bem rápido e os adesivin  
muito fácil e rápido foi pra adquirir com ela!!"


### Discussion #278 by @dancersoojin
> **Author:** [@dancersoojin](https://x.com/dancersoojin)  
> **Metrics:** 1 likes · 0 retweets · 0 comments · 19 views  

> **Posted:** 2026-09-29T19:30:11+00:00  


> **Source Link:** [https://x.com/dancersoojin/status/2105017314856894809](https://x.com/dancersoojin/status/2105017314856894809)  


> **Visual Context:** A decorated bag or organizer with various K-pop photos, plush keychains, and stickers featuring artists, alongside text including 'i FEEL', 'kudos', and 'Next Chapter'.  

> 
> "eu quero mto uma itabag afff"


### Discussion #279 by @IrakozEster
> **Author:** [@IrakozEster](https://x.com/IrakozEster)  
> **Metrics:** 3 likes · 2 retweets · 0 comments · 18 views  

> **Posted:** 2026-09-29T19:44:37+00:00  


> **Source Link:** [https://x.com/IrakozEster/status/2105020946067157210](https://x.com/IrakozEster/status/2105020946067157210)  


> 
> "Wawoo come and look how you can make good image of your house"


### Discussion #280 by @artikbidur
> **Author:** [@artikbidur](https://x.com/artikbidur)  
> **Metrics:** 0 likes · 0 retweets · 0 comments · 18 views  

> **Posted:** 2026-09-29T19:50:17+00:00  


> **Source Link:** [https://x.com/artikbidur/status/2105022371627454523](https://x.com/artikbidur/status/2105022371627454523)  


> **Visual Context:** A man sits in a chair next to a giant sculpted head of a sleeping woman in what appears to be a stage or art installation.  

> 
> "Bu neyin kafası"


### Discussion #281 by @Flowers851401
> **Author:** [@Flowers851401](https://x.com/Flowers851401)  
> **Metrics:** 1 likes · 0 retweets · 0 comments · 17 views  

> **Posted:** 2026-09-29T19:14:21+00:00  


> **Source Link:** [https://x.com/Flowers851401/status/2105013327017771379](https://x.com/Flowers851401/status/2105013327017771379)  


> 
> "OMG"


### Discussion #282 by @0xALTF4
> **Author:** [@0xALTF4](https://x.com/0xALTF4)  
> **Metrics:** 0 likes · 0 retweets · 0 comments · 14 views  

> **Posted:** 2026-09-29T19:55:35+00:00  


> **Source Link:** [https://x.com/0xALTF4/status/2105023705818571226](https://x.com/0xALTF4/status/2105023705818571226)  


> 
> "Nice"


### Discussion #283 by @selor
> **Author:** [@selor](https://x.com/selor)  
> **Metrics:** 0 likes · 0 retweets · 0 comments · 14 views  

> **Posted:** 2026-09-29T19:50:29+00:00  


> **Source Link:** [https://x.com/selor/status/2105022420985770193](https://x.com/selor/status/2105022420985770193)  


> 
> "Sleep tight hart"


### Discussion #284 by @dareal_auto
> **Author:** [@dareal_auto](https://x.com/dareal_auto)  
> **Metrics:** 2 likes · 1 retweets · 1 comments · 13 views  

> **Posted:** 2026-09-29T19:37:02+00:00  


> **Source Link:** [https://x.com/dareal_auto/status/2105019038225039693](https://x.com/dareal_auto/status/2105019038225039693)  


> 
> "My most retweeted car listed
My most bookmarked car listed
My most viewed car listed
Tweet with most replies car listed 
@grok"


### Discussion #285 by @_dam_ing
> **Author:** [@_dam_ing](https://x.com/_dam_ing)  
> **Metrics:** 2 likes · 0 retweets · 0 comments · 12 views  

> **Posted:** 2026-09-29T19:13:34+00:00  


> **Source Link:** [https://x.com/_dam_ing/status/2105013133475823639](https://x.com/_dam_ing/status/2105013133475823639)  


> **Visual Context:** A close-up shows a customized BJD doll with large gray eyes, brown hair, and a fuzzy white bunny-eared hat wearing a pink sweater.  

> 
> "토끼 ₍ᐢ..ᐢ₎"


### Discussion #286 by @florene20404
> **Author:** [@florene20404](https://x.com/florene20404)  
> **Metrics:** 1 likes · 2 retweets · 3 comments · 12 views  

> **Posted:** 2026-09-29T19:40:21+00:00  


> **Source Link:** [https://x.com/florene20404/status/2105019869985128637](https://x.com/florene20404/status/2105019869985128637)  


> 
> "宁波 海曙 慈溪
N6XCilK
资源
@Spa_95v98
 按摩"


### Discussion #287 by @misanasprincess
> **Author:** [@misanasprincess](https://x.com/misanasprincess)  
> **Metrics:** 1 likes · 0 retweets · 0 comments · 12 views  

> **Posted:** 2026-09-29T19:45:00+00:00  


> **Source Link:** [https://x.com/misanasprincess/status/2105021040581886325](https://x.com/misanasprincess/status/2105021040581886325)  


> 
> "it’s only 8:40pm but i’m so sleepy"


### Discussion #288 by @Delfiearts
> **Author:** [@Delfiearts](https://x.com/Delfiearts)  
> **Metrics:** 1 likes · 0 retweets · 2 comments · 12 views  

> **Posted:** 2026-09-29T18:32:40+00:00  


> **Source Link:** [https://x.com/Delfiearts/status/2105002840402071962](https://x.com/Delfiearts/status/2105002840402071962)  


> 
> "Need 3000 Verified followers 

Just Say >>>> Need

I will follow you ASAP"


### Discussion #289 by @SoyeonForever87
> **Author:** [@SoyeonForever87](https://x.com/SoyeonForever87)  
> **Metrics:** 1 likes · 0 retweets · 0 comments · 11 views  

> **Posted:** 2026-09-29T19:28:48+00:00  


> **Source Link:** [https://x.com/SoyeonForever87/status/2105016965505200162](https://x.com/SoyeonForever87/status/2105016965505200162)  


> 
> "I really need these two to step on me at the same time and make it hurt a little."


### Discussion #290 by @en_rostamzadeh
> **Author:** [@en_rostamzadeh](https://x.com/en_rostamzadeh)  
> **Metrics:** 1 likes · 0 retweets · 0 comments · 9 views  

> **Posted:** 2026-09-29T18:52:25+00:00  


> **Source Link:** [https://x.com/en_rostamzadeh/status/2105007810815930714](https://x.com/en_rostamzadeh/status/2105007810815930714)  


> **Visual Context:** A cartoon character with oversized white eyes and a business suit sits behind a desk, with a speech bubble reading "Busy Week Ahead. I Dressed For It." The whimsical office scene features framed portraits on the wall and a corkboard with notes, likely serving as a playful meme tied to the referenced Twitter account @en_rostamzadeh.  

> 
> "x.com/en_rostamzadeh
…"


### Discussion #291 by @aureljpeg
> **Author:** [@aureljpeg](https://x.com/aureljpeg)  
> **Metrics:** 0 likes · 0 retweets · 0 comments · 9 views  

> **Posted:** 2026-09-29T19:51:28+00:00  


> **Source Link:** [https://x.com/aureljpeg/status/2105022667682459951](https://x.com/aureljpeg/status/2105022667682459951)  


> 
> "My talent is identifying birds"


### Discussion #292 by @dear6angel
> **Author:** [@dear6angel](https://x.com/dear6angel)  
> **Metrics:** 1 likes · 0 retweets · 0 comments · 7 views  

> **Posted:** 2026-09-29T18:58:20+00:00  


> **Source Link:** [https://x.com/dear6angel/status/2105009297943904325](https://x.com/dear6angel/status/2105009297943904325)  


> 
> "eu"


### Discussion #293 by @LlVEMYLlFE
> **Author:** [@LlVEMYLlFE](https://x.com/LlVEMYLlFE)  
> **Metrics:** 1 likes · 0 retweets · 0 comments · 7 views  

> **Posted:** 2026-09-29T18:45:35+00:00  


> **Source Link:** [https://x.com/LlVEMYLlFE/status/2105006091436453975](https://x.com/LlVEMYLlFE/status/2105006091436453975)  


> 
> "attention, please!"


### Discussion #294 by @McCain889
> **Author:** [@McCain889](https://x.com/McCain889)  
> **Metrics:** 0 likes · 0 retweets · 0 comments · 7 views  

> **Posted:** 2026-09-29T19:53:50+00:00  


> **Source Link:** [https://x.com/McCain889/status/2105023264498311401](https://x.com/McCain889/status/2105023264498311401)  


> 
> "the snooze button is already nervous"


### Discussion #295 by @memofielld
> **Author:** [@memofielld](https://x.com/memofielld)  
> **Metrics:** 2 likes · 0 retweets · 1 comments · 6 views  

> **Posted:** 2026-09-29T19:47:58+00:00  


> **Source Link:** [https://x.com/memofielld/status/2105021790204653868](https://x.com/memofielld/status/2105021790204653868)  


> 
> "Toparlayamazsak dağıtırız"


### Discussion #296 by @DD____
> **Author:** [@DD____](https://x.com/DD____)  
> **Metrics:** 0 likes · 0 retweets · 0 comments · 6 views  

> **Posted:** 2026-09-29T19:51:57+00:00  


> **Source Link:** [https://x.com/DD____/status/2105022789375942919](https://x.com/DD____/status/2105022789375942919)  


> 
> "This is huge"


### Discussion #297 by @ItsaMeCooper
> **Author:** [@ItsaMeCooper](https://x.com/ItsaMeCooper)  
> **Metrics:** 1 likes · 0 retweets · 0 comments · 5 views  

> **Posted:** 2026-09-29T19:41:12+00:00  


> **Source Link:** [https://x.com/ItsaMeCooper/status/2105020087446966484](https://x.com/ItsaMeCooper/status/2105020087446966484)  


> 
> "Sick. Need this"


### Discussion #298 by @DD____
> **Author:** [@DD____](https://x.com/DD____)  
> **Metrics:** 1 likes · 0 retweets · 0 comments · 5 views  

> **Posted:** 2026-09-29T19:53:57+00:00  


> **Source Link:** [https://x.com/DD____/status/2105023294458253820](https://x.com/DD____/status/2105023294458253820)  


> 
> "we ball"


### Discussion #299 by @DD____
> **Author:** [@DD____](https://x.com/DD____)  
> **Metrics:** 0 likes · 0 retweets · 0 comments · 5 views  

> **Posted:** 2026-09-29T19:56:51+00:00  


> **Source Link:** [https://x.com/DD____/status/2105024022539120665](https://x.com/DD____/status/2105024022539120665)  


> 
> "看透本质"


### Discussion #300 by @Delfiearts
> **Author:** [@Delfiearts](https://x.com/Delfiearts)  
> **Metrics:** 2 likes · 0 retweets · 1 comments · 4 views  

> **Posted:** 2026-09-29T19:37:46+00:00  


> **Source Link:** [https://x.com/Delfiearts/status/2105019221424148783](https://x.com/Delfiearts/status/2105019221424148783)  


> **Visual Context:** A celebratory graphic with green text reading '10000 FOLLOWERS' displayed on a white reflective background.  

> 
> "Need 10000 followers 

Just say >>>> Yes

I will follow you now"


### Discussion #301 by @DD____
> **Author:** [@DD____](https://x.com/DD____)  
> **Metrics:** 0 likes · 0 retweets · 0 comments · 4 views  

> **Posted:** 2026-09-29T19:58:51+00:00  


> **Source Link:** [https://x.com/DD____/status/2105024528724496556](https://x.com/DD____/status/2105024528724496556)  


> 
> "Get well soon"


### Discussion #302 by @kamand_kavand
> **Author:** [@kamand_kavand](https://x.com/kamand_kavand)  
> **Metrics:** 0 likes · 0 retweets · 0 comments · 4 views  

> **Posted:** 2026-09-29T19:55:49+00:00  


> **Source Link:** [https://x.com/kamand_kavand/status/2105023766321389719](https://x.com/kamand_kavand/status/2105023766321389719)  


> 
> "Congrats"


### Discussion #303 by @cheuk_baby
> **Author:** [@cheuk_baby](https://x.com/cheuk_baby)  
> **Metrics:** 0 likes · 0 retweets · 0 comments · 4 views  

> **Posted:** 2026-09-29T19:56:32+00:00  


> **Source Link:** [https://x.com/cheuk_baby/status/2105023944768274603](https://x.com/cheuk_baby/status/2105023944768274603)  


> 
> "这么多皮卡丘啊"


### Discussion #304 by @tweetbysherf004
> **Author:** [@tweetbysherf004](https://x.com/tweetbysherf004)  
> **Metrics:** 0 likes · 0 retweets · 0 comments · 4 views  

> **Posted:** 2026-09-29T19:55:22+00:00  


> **Source Link:** [https://x.com/tweetbysherf004/status/2105023652018221426](https://x.com/tweetbysherf004/status/2105023652018221426)  


> 
> "Congratulations champ"


### Discussion #305 by @Jannat188219
> **Author:** [@Jannat188219](https://x.com/Jannat188219)  
> **Metrics:** 0 likes · 0 retweets · 0 comments · 4 views  

> **Posted:** 2026-09-29T17:08:41+00:00  


> **Source Link:** [https://x.com/Jannat188219/status/2104981702615720425](https://x.com/Jannat188219/status/2104981702615720425)  


> 
> "Good Night"


### Discussion #306 by @LisaLisa
> **Author:** [@LisaLisa](https://x.com/LisaLisa)  
> **Metrics:** 0 likes · 0 retweets · 0 comments · 3 views  

> **Posted:** 2026-09-29T18:12:50+00:00  


> **Source Link:** [https://x.com/LisaLisa/status/2104997846814490931](https://x.com/LisaLisa/status/2104997846814490931)  


> 
> "Super gm to you tandis!"


### Discussion #307 by @Rizvi_On_X
> **Author:** [@Rizvi_On_X](https://x.com/Rizvi_On_X)  
> **Metrics:** 0 likes · 0 retweets · 0 comments · 2 views  

> **Posted:** 2026-09-29T19:47:34+00:00  


> **Source Link:** [https://x.com/Rizvi_On_X/status/2105021688337572089](https://x.com/Rizvi_On_X/status/2105021688337572089)  


> 
> "That 5 day streak thing actually makes me want to check in."


### Discussion #308 by @VPhm23380671
> **Author:** [@VPhm23380671](https://x.com/VPhm23380671)  
> **Metrics:** 0 likes · 0 retweets · 0 comments · 2 views  

> **Posted:** 2026-09-29T16:48:50+00:00  


> **Source Link:** [https://x.com/VPhm23380671/status/2104976708067897551](https://x.com/VPhm23380671/status/2104976708067897551)  


> 
> "Exciting rewards for active participants"


### Discussion #309 by @kamand_kavand
> **Author:** [@kamand_kavand](https://x.com/kamand_kavand)  
> **Metrics:** 0 likes · 0 retweets · 0 comments · 2 views  

> **Posted:** 2026-09-29T19:57:15+00:00  


> **Source Link:** [https://x.com/kamand_kavand/status/2105024125500842439](https://x.com/kamand_kavand/status/2105024125500842439)  


> 
> "Congrats"


### Discussion #310 by @MadMagicSOL
> **Author:** [@MadMagicSOL](https://x.com/MadMagicSOL)  
> **Metrics:** 0 likes · 0 retweets · 0 comments · 2 views  

> **Posted:** 2026-09-29T19:51:54+00:00  


> **Source Link:** [https://x.com/MadMagicSOL/status/2105022778965655811](https://x.com/MadMagicSOL/status/2105022778965655811)  


> 
> "Sounds too good, honestly"


### Discussion #311 by @TSSalamander
> **Author:** [@TSSalamander](https://x.com/TSSalamander)  
> **Metrics:** 0 likes · 0 retweets · 0 comments · 1 views  

> **Posted:** 2026-09-29T19:56:36+00:00  


> **Source Link:** [https://x.com/TSSalamander/status/2105023960618508674](https://x.com/TSSalamander/status/2105023960618508674)  


> 
> "[sic] is the kind of annotation people use when they want to bully you. They don't do it when they want to handle your statement in good faith."


### Discussion #312 by @ni_celeb
> **Author:** [@ni_celeb](https://x.com/ni_celeb)  
> **Metrics:** 0 likes · 0 retweets · 0 comments · 1 views  

> **Posted:** 2026-09-29T19:36:13+00:00  


> **Source Link:** [https://x.com/ni_celeb/status/2105018833434193937](https://x.com/ni_celeb/status/2105018833434193937)  


> 
> "ngủ sớm vậy mà trong mơ “có hết” nghe cũng ham thiệt"


### Discussion #313 by @0x_Coop
> **Author:** [@0x_Coop](https://x.com/0x_Coop)  
> **Metrics:** 0 likes · 0 retweets · 0 comments · 1 views  

> **Posted:** 2026-09-29T19:51:02+00:00  


> **Source Link:** [https://x.com/0x_Coop/status/2105022560442421497](https://x.com/0x_Coop/status/2105022560442421497)  


> 
> "this sounds intriguing what a unique concept"


### Discussion #314 by @NukeGold
> **Author:** [@NukeGold](https://x.com/NukeGold)  
> **Metrics:** 0 likes · 0 retweets · 0 comments · 1 views  

> **Posted:** 2026-09-29T19:58:03+00:00  


> **Source Link:** [https://x.com/NukeGold/status/2105024326172844333](https://x.com/NukeGold/status/2105024326172844333)  


> 
> "it's fake."


### Discussion #315 by @tweetbysherf004
> **Author:** [@tweetbysherf004](https://x.com/tweetbysherf004)  
> **Metrics:** 0 likes · 0 retweets · 0 comments · 1 views  

> **Posted:** 2026-09-29T19:55:37+00:00  


> **Source Link:** [https://x.com/tweetbysherf004/status/2105023715897487531](https://x.com/tweetbysherf004/status/2105023715897487531)  


> 
> "Gg oba"


### Discussion #316 by @Kylechasse
> **Author:** [@Kylechasse](https://x.com/Kylechasse)  
> **Metrics:** 1 likes · 0 retweets · 0 comments · 0 views  

> **Posted:** 2026-09-29T19:59:11+00:00  


> **Source Link:** [https://x.com/Kylechasse/status/2105024610081349854](https://x.com/Kylechasse/status/2105024610081349854)  


> 
> "Thinking about top blasting!!"


### Discussion #317 by @0x_Coop
> **Author:** [@0x_Coop](https://x.com/0x_Coop)  
> **Metrics:** 0 likes · 0 retweets · 0 comments · 0 views  

> **Posted:** 2026-09-29T19:53:52+00:00  


> **Source Link:** [https://x.com/0x_Coop/status/2105023271829950784](https://x.com/0x_Coop/status/2105023271829950784)  


> 
> "planning your day with trending news is smart"


### Discussion #318 by @reddit
> **Author:** [@reddit](https://x.com/reddit)  
> **Metrics:** 0 likes · 0 retweets · 2 comments · 0 views  

> **Posted:** 2026-09-29T16:51:15.533000+00:00  



> 
> "1889 Silver Dollar"


### Discussion #319 by @Holy_Shock
> **Author:** [@Holy_Shock](https://x.com/Holy_Shock)  
> **Metrics:** 0 likes · 0 retweets · 0 comments · 0 views  

> **Posted:** 2026-09-29T19:50:18+00:00  


> **Source Link:** [https://x.com/Holy_Shock/status/2105022377260462095](https://x.com/Holy_Shock/status/2105022377260462095)  


> 
> "keeping me at arms length i see"


### Discussion #320 by @Holy_Shock
> **Author:** [@Holy_Shock](https://x.com/Holy_Shock)  
> **Metrics:** 0 likes · 0 retweets · 0 comments · 0 views  

> **Posted:** 2026-09-29T19:48:36+00:00  


> **Source Link:** [https://x.com/Holy_Shock/status/2105021949525336336](https://x.com/Holy_Shock/status/2105021949525336336)  


> 
> "you? Atlanta"


### Discussion #321 by @cheuk_baby
> **Author:** [@cheuk_baby](https://x.com/cheuk_baby)  
> **Metrics:** 0 likes · 0 retweets · 0 comments · 0 views  

> **Posted:** 2026-09-29T19:57:52+00:00  


> **Source Link:** [https://x.com/cheuk_baby/status/2105024280279056603](https://x.com/cheuk_baby/status/2105024280279056603)  


> 
> "哦他这人还挺实在的"